Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.90
PubTator Score 2.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma 1.100 1.8e-03
atypical teratoid / rhabdoid tumor 1.300 4.2e-07
ependymoma 1.400 4.4e-03
glioblastoma 1.300 1.4e-04
group 3 medulloblastoma 1.400 4.5e-03
medulloblastoma, large-cell 1.100 2.9e-03
ovarian cancer -2.800 7.2e-17

Synonym

Accession Q96BU1 B3KR04 D3DPQ5 Q5HYH3 Q9H997
Symbols S100PBPR

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (4)

AA Sequence

MMCSRVPSEQSSGTSLLPKDGAPFSWDSLDEDGLDDSLLELSEGEEDDGDVNYTEEEIDALLKEDDPSYE      1 - 70
QSSGEDDGGHVEKGERGSQILLDTPREKNSSYSLGPVAETPDLFKLPQLSTSSGHGPAHTKPLNRRSVLE     71 - 140
KNLIKVTVAPFNPTVCDALLDKDETDSSKDTEKLSSLGEEMREDGLSPNESKLCTESEGISPNNSAWNGP    141 - 210
QLSSSNNNFQQTVSDKNMPDSENPTSVFSRISDHSETPNMELSCRNGGSHKSSCEMRSLVVSTSSNKQDV    211 - 280
LNKDSGKMKGHERRLGKVIPVLQTKTRTNVPTFSQSNLEQQKQLYLRSVIAHIEDPEDTNQGISGELCAL    281 - 350
MDQVHHMQHSKWQHPSDLTTRNYARRQKHLQRYSLTQWVDRNMRSHHRFQRLPDFSYS                351 - 408
//

Text Mined References (11)

PMID Year Title