Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.90
PubTator Score 2.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 7.1576451138437E-17
atypical teratoid / rhabdoid tumor 4369 4.18960615481273E-7
glioblastoma 5572 1.42917834456106E-4
astrocytic glioma 2241 0.00179528774851931
medulloblastoma, large-cell 6234 0.00292527156719871
ependymoma 2514 0.00444512870215033
group 3 medulloblastoma 2254 0.00453716730592875
Disease Target Count Z-score Confidence
Pancreatic ductal adenocarcinoma 1 3.112 1.6

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma 1.100 0.002
ependymoma 1.400 0.004
group 3 medulloblastoma 1.400 0.005
atypical teratoid / rhabdoid tumor 1.300 0.000
glioblastoma 1.300 0.000
medulloblastoma, large-cell 1.100 0.003
ovarian cancer -2.800 0.000

Synonym

Accession Q96BU1 B3KR04 D3DPQ5 Q5HYH3 Q9H997
Symbols S100PBPR

Gene

  Ortholog (7)

Gene RIF (4)

PMID Text
25156441 Low S100PBP expression is associated with cervical cancer.
22330678 S100P-binding protein mediates adhesion through regulation of cathepsin Z in pancreatic cancer cells.
18089492 S100P is a sensitive and specific marker for the detection of pancreatic ductal adenocarcinoma on FNAB specimens on cell-block and smear preparations.
15632002 can be added to the genetic progression model for pancreatic ductal adenocarcinoma.

AA Sequence

MMCSRVPSEQSSGTSLLPKDGAPFSWDSLDEDGLDDSLLELSEGEEDDGDVNYTEEEIDALLKEDDPSYE      1 - 70
QSSGEDDGGHVEKGERGSQILLDTPREKNSSYSLGPVAETPDLFKLPQLSTSSGHGPAHTKPLNRRSVLE     71 - 140
KNLIKVTVAPFNPTVCDALLDKDETDSSKDTEKLSSLGEEMREDGLSPNESKLCTESEGISPNNSAWNGP    141 - 210
QLSSSNNNFQQTVSDKNMPDSENPTSVFSRISDHSETPNMELSCRNGGSHKSSCEMRSLVVSTSSNKQDV    211 - 280
LNKDSGKMKGHERRLGKVIPVLQTKTRTNVPTFSQSNLEQQKQLYLRSVIAHIEDPEDTNQGISGELCAL    281 - 350
MDQVHHMQHSKWQHPSDLTTRNYARRQKHLQRYSLTQWVDRNMRSHHRFQRLPDFSYS                351 - 408
//

Text Mined References (11)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
25156441 2015 Novel functions and targets of miR-944 in human cervical cancer cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22330678 2012 S100P-binding protein, S100PBP, mediates adhesion through regulation of cathepsin Z in pancreatic cancer cells.
18089492 2008 Usefulness of S100P in diagnosis of adenocarcinoma of pancreas on fine-needle aspiration biopsy specimens.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15632002 2005 Expression of S100P and its novel binding partner S100PBPR in early pancreatic cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...