Property Summary

NCBI Gene PubMed Count 11
PubMed Score 18.04
PubTator Score 11.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Breast Neoplasms 445 0.0 0.0
Neoplasm Invasiveness 161 0.0 0.0
Disease Target Count P-value
osteosarcoma 7950 3.6e-06
Pilocytic astrocytoma 56 8.5e-05
medulloblastoma, large-cell 6241 1.5e-04
ovarian cancer 8520 1.7e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (4)

Disease log2 FC p
medulloblastoma, large-cell 1.200 1.5e-04
osteosarcoma -2.664 3.6e-06
ovarian cancer 1.100 1.7e-03
Pilocytic astrocytoma 1.100 8.5e-05

Gene RIF (6)

AA Sequence

MDSNHQSNYKLSKTEKKFLRKQIKAKHTLLRHEGIETVSYATQSLVVANGGLGNGVSRNQLLPVLEKCGL      1 - 70
VDALLMPPNKPYSFARYRTTEESKRAYVTLNGKEVVDDLGQKITLYLNFVEKVQWKELRPQALPPGLMVV     71 - 140
EEIISSEEEKMLLESVDWTEDTDNQNSQKSLKHRRVKHFGYEFHYENNNVDKDKPLSGGLPDICESFLEK    141 - 210
WLRKGYIKHKPDQMTINQYEPGQGIPAHIDTHSAFEDEIVSLSLGSEIVMDFKHPDGIAVPVMLPRRSLL    211 - 280
VMTGESRYLWTHGITCRKFDTVQASESLKSGIITSDVGDLTLSKRGLRTSFTFRKVRQTPCNCSYPLVCD    281 - 350
SQRKETPPSFPESDKEASRLEQEYVHQVYEEIAGHFSSTRHTPWPHIVEFLKALPSGSIVADIGCGNGKY    351 - 420
LGINKELYMIGCDRSQNLVDICRERQFQAFVCDALAVPVRSGSCDACISIAVIHHFATAERRVAALQEIV    421 - 490
RLLRPGGKALIYVWAMEQEYNKQKSKYLRGNRNSQGKKEEMNSDTSVQRSLVEQMRDMGSRDSASSVPRI    491 - 560
NDSQEGGCNSRQVSNSKLPVHVNRTSFYSQDVLVPWHLKGNPDKGKPVEPFGPIGSQDPSPVFHRYYHVF    561 - 630
REGELEGACRTVSDVRILQSYYDQGNWCVILQKA                                        631 - 664
//

Text Mined References (14)

PMID Year Title