Property Summary

NCBI Gene PubMed Count 20
Grant Count 9
R01 Count 9
Funding $866,374.45
PubMed Score 15.50
PubTator Score 13.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis -2.200 0.000
osteosarcoma -2.693 0.000
Pick disease -1.600 0.000

 GO Function (1)

Gene RIF (8)

PMID Text
25843710 We used a synthetic system to dissect how CenH3(CENP-A) contributes to the accumulation of CENP-C and CENP-T, two key components that are necessary for the formation of functional kinetochores
25660545 CENP-T directly interacts with Ndc80, which in turn promotes KNL1/Mis12 complex recruitment at kinetochores during chromosome segregation.
23926101 CSN5 regulates the stability of the inner kinetochore components CENP-T and CENP-W, providing the first direct link between CSN5 and the mitotic apparatus, highlighting the role of CSN5 as a multifunctional cell cycle regulator.
23334297 CENP-T provides a structural platform for outer kinetochore assembly.
22561346 results reveal the molecular function of CENP-T proteins and demonstrate how the Ndc80 complex is anchored to centromeres in a manner that couples chromosome movement to spindle dynamics
21695110 The CENP-T/W complex assembles through a dynamic exchange mechanism in late S-phase and G2, is required for mitosis in each cell cycle and does not persist across cell generations.
19412974 CENP-T exchange into centromeres is restricted to the S-phase of the cell cycle as revealed by FRAP, suggesting a coreplicational loading mechanism.
19070575 Study demonstrates that CENP-W forms a DNA-binding complex together with the CCAN component CENP-T; this complex directly associates with nucleosomal DNA and with canonical histone H3, but not with CENP-A, in centromeric regions.

AA Sequence

MADHNPDSDSTPRTLLRRVLDTADPRTPRRPRSARAGARRALLETASPRKLSGQTRTIARGRSHGARSVG      1 - 70
RSAHIQASGHLEEQTPRTLLKNILLTAPESSILMPESVVKPVPAPQAVQPSRQESSCGSLELQLPELEPP     71 - 140
TTLAPGLLAPGRRKQRLRLSVFQQGVDQGLSLSQEPQGNADASSLTRSLNLTFATPLQPQSVQRPGLARR    141 - 210
PPARRAVDVGAFLRDLRDTSLAPPNIVLEDTQPFSQPMVGSPNVYHSLPCTPHTGAEDAEQAAGRKTQSS    211 - 280
GPGLQKNSPGKPAQFLAGEAEEVNAFALGFLSTSSGVSGEDEVEPLHDGVEEAEKKMEEEGVSVSEMEAT    281 - 350
GAQGPSRVEEAEGHTEVTEAEGSQGTAEADGPGASSGDEDASGRAASPESASSTPESLQARRHHQFLEPA    351 - 420
PAPGAAVLSSEPAEPLLVRHPPRPRTTGPRPRQDPHKAGLSHYVKLFSFYAKMPMERKALEMVEKCLDKY    421 - 490
FQHLCDDLEVFAAHAGRKTVKPEDLELLMRRQGLVTDQVSLHVLVERHLPLEYRQLLIPCAYSGNSVFPA    491 - 560
Q//

Text Mined References (28)

PMID Year Title
27499292 2016 The Flexible Ends of CENP-A Nucleosome Are Required for Mitotic Fidelity.
25843710 2015 HJURP involvement in de novo CenH3(CENP-A) and CENP-C recruitment.
25660545 2015 Distinct organization and regulation of the outer kinetochore KMN network downstream of CENP-C and CENP-T.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
23926101 2013 CSN5/JAB1 interacts with the centromeric components CENP-T and CENP-W and regulates their proteasome-mediated degradation.
23334297 2013 CENP-T provides a structural platform for outer kinetochore assembly.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22561346 2012 CENP-T proteins are conserved centromere receptors of the Ndc80 complex.
22304917 2012 CENP-T-W-S-X forms a unique centromeric chromatin structure with a histone-like fold.
21695110 2011 Premitotic assembly of human CENPs -T and -W switches centromeric chromatin to a mitotic state.
More...