Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Schizophrenia 501

Expression

Synonym

Accession Q96BT1
Symbols

Gene

 Compartment GO Term (1)

AA Sequence

MAQPQLYLPEPFKIAYRKVGQCRRFQQLKKKNGSFKRKGIERWHRAVSTNLLKQNVLVPKEESSSDSDMG      1 - 70
FHESQQNQKSNLKTKVKTAFGRMLSYKYRSKPACASQEGSTDHKEALLSNTQSLLPRIVKEFSSPKLFTA     71 - 140
KMRKLSENATIQLDVVEAETEEITQGNTLLRARRTTKRLSVTSLPSGLQKGPYSPKKRPHFPALKKKKRG    141 - 210
MENILRKSDLTVGKLQMQVDDLIETVTDKSMKLLAQRHAELQQCEFLGDEILQSSKQFQRISKRTMRKYK    211 - 280
LKNMTTKGPGDS                                                              281 - 292
//

Text Mined References (6)

PMID Year Title
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24023788 2013 Gene network analysis in a pediatric cohort identifies novel lung function genes.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15203218 2004 Circular rapid amplification of cDNA ends for high-throughput extension cloning of partial genes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.