Property Summary

NCBI Gene PubMed Count 19
Grant Count 492
R01 Count 241
Funding $61,392,222.41
PubMed Score 17.27
PubTator Score 8.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
astrocytic glioma -1.400 0.039
esophageal adenocarcinoma 1.900 0.020
osteosarcoma -3.869 0.000
chronic lymphosyte leukemia 1.100 0.000
group 4 medulloblastoma -1.600 0.001
glioblastoma -1.100 0.037
medulloblastoma, large-cell -1.900 0.000
primitive neuroectodermal tumor -1.200 0.014
adrenocortical carcinoma -1.776 0.000
intraductal papillary-mucinous adenoma (... 1.100 0.003
lung cancer 1.200 0.001
active Crohn's disease 1.457 0.004
active ulcerative colitis 2.046 0.008
breast carcinoma -1.700 0.000
interstitial cystitis -2.300 0.000
lung adenocarcinoma 1.300 0.000
non-inflammatory breast cancer -4.700 0.000
lung carcinoma 1.600 0.000
invasive ductal carcinoma -1.100 0.001
pituitary cancer 1.100 0.022
psoriasis -1.200 0.000

Synonym

Accession Q96BS2 F5H1Y5 Q9NWT9
Symbols TSC
CHP3

Gene

Gene RIF (7)

PMID Text
25935310 CHP3 functions as a novel negative regulator of cardiomyocyte hypertrophy via inhibition of GSK3alpha/beta phosphorylation.
24811141 TESC is overexpressed in colorectal cancer
24776739 This study demonstrated that highly significant effects of rs7294919 of tescalcin on hippocampal gray matter volumes.
24659803 a binding partner and regulator of subunit 4 of the COP9 signalosome
22984264 Loss of both N-myristoylation and calcium binding of CHP3 decreases cell surface stability of NHE1.
20060826 Tescalcin is one of the key gene products that is involved in switching differentiation program in some cell types.
18321853 CHP3 binds directly to the proximal juxtamembrane C-terminal region (amino acids 505-571) of rat NHE1 in the same region that binds CHP1 and CHP2.

AA Sequence

MGAAHSASEEVRELEGKTGFSSDQIEQLHRRFKQLSGDQPTIRKENFNNVPDLELNPIRSKIVRAFFDNR      1 - 70
NLRKGPSGLADEINFEDFLTIMSYFRPIDTTMDEEQVELSRKEKLRFLFHMYDSDSDGRITLEEYRNVVE     71 - 140
ELLSGNPHIEKESARSIADGAMMEAASVCMGQMEPDQVYEGITFEDFLKIWQGIDIETKMHVRFLNMETM    141 - 210
ALCH                                                                      211 - 214
//

Text Mined References (25)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25935310 2015 Calcineurin B homologous protein 3 negatively regulates cardiomyocyte hypertrophy via inhibition of glycogen synthase kinase 3 phosphorylation.
25807930 2015 Multifunctional reagents for quantitative proteome-wide analysis of protein modification in human cells and dynamic profiling of protein lipidation during vertebrate development.
25416956 2014 A proteome-scale map of the human interactome network.
25255805 2014 Global profiling of co- and post-translationally N-myristoylated proteomes in human cells.
24811141 2014 The EF-hand calcium-binding protein tescalcin is a potential oncotarget in colorectal cancer.
24776739 2015 Multimodal imaging of a tescalcin (TESC)-regulating polymorphism (rs7294919)-specific effects on hippocampal gray matter structure.
24659803 2014 Regulation of Cop9 signalosome activity by the EF-hand Ca2+-binding protein tescalcin.
22984264 2012 N-myristoylation and Ca2+ binding of calcineurin B homologous protein CHP3 are required to enhance Na+/H+ exchanger NHE1 half-life and activity at the plasma membrane.
21553168 2011 Controlled release systems containing solid dispersions: strategies and mechanisms.
More...