Property Summary

NCBI Gene PubMed Count 20
PubMed Score 18.34
PubTator Score 8.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
active Crohn's disease 1.457 3.8e-03
active ulcerative colitis 2.046 7.9e-03
adrenocortical carcinoma -1.776 8.7e-05
astrocytic glioma -1.400 3.9e-02
Breast cancer -1.100 2.1e-19
breast carcinoma -1.700 2.8e-05
chronic lymphosyte leukemia 1.100 2.3e-05
esophageal adenocarcinoma 1.900 2.0e-02
glioblastoma -1.100 3.7e-02
group 4 medulloblastoma -1.600 9.4e-04
interstitial cystitis -2.200 1.7e-03
intraductal papillary-mucinous adenoma (... 1.100 3.3e-03
invasive ductal carcinoma -1.100 6.6e-04
lung adenocarcinoma 1.300 2.2e-05
lung cancer 1.200 6.6e-04
lung carcinoma 1.600 1.2e-28
medulloblastoma, large-cell -1.900 1.0e-04
osteosarcoma -3.869 1.5e-04
pituitary cancer 1.100 2.2e-02
primitive neuroectodermal tumor -1.200 1.4e-02
psoriasis -1.200 8.6e-31

Gene RIF (8)

AA Sequence

MGAAHSASEEVRELEGKTGFSSDQIEQLHRRFKQLSGDQPTIRKENFNNVPDLELNPIRSKIVRAFFDNR      1 - 70
NLRKGPSGLADEINFEDFLTIMSYFRPIDTTMDEEQVELSRKEKLRFLFHMYDSDSDGRITLEEYRNVVE     71 - 140
ELLSGNPHIEKESARSIADGAMMEAASVCMGQMEPDQVYEGITFEDFLKIWQGIDIETKMHVRFLNMETM    141 - 210
ALCH                                                                      211 - 214
//

Text Mined References (26)

PMID Year Title