Property Summary

NCBI Gene PubMed Count 13
PubMed Score 1.19
PubTator Score 1.40

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

AA Sequence

MEISSHQSHLLQQLNEQRRQDVFCDCSILVEGKVFKAHRNVLFASSGYFKMLLSQNSKETSQPTTATFQA      1 - 70
FSPDTFTVILDFVYSGKLSLTGQNVIEVMSAASFLQMTDVISVCKTFIKSSLDISEKEKDRYFSLSDKDA     71 - 140
NSNGVERSSFYSGGWQEGSSSPRSHLSPEQGTGIISGKSWNKYNYHPASQKNTQQPLAKHEPRKESIKKT    141 - 210
KHLRLSQPSEVTHYKSSKREVRTSDSSSHVSQSEEQAQIDAEMDSTPVGYQYGQGSDVTSKSFPDDLPRM    211 - 280
RFKCPYCTHVVKRKADLKRHLRCHTGERPYPCQACGKRFSRLDHLSSHFRTIHQACKLICRKCKRHVTDL    281 - 350
TGQVVQEGTRRYRLCNECLAEFGIDSLPIDLEAEQHLMSPSDGDKDSRWHLSEDENRSYVEIVEDGSGDL    351 - 420
VIQQVDDSEEEEEKEIKPNIR                                                     421 - 441
//

Text Mined References (20)

PMID Year Title