Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
primitive neuroectodermal tumor 3035 5.0e-05
group 3 medulloblastoma 4104 1.0e-04
osteosarcoma 7950 1.0e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (3)

Disease log2 FC p
group 3 medulloblastoma 1.500 1.0e-04
osteosarcoma 1.108 1.0e-03
primitive neuroectodermal tumor 1.400 5.0e-05

 GWAS Trait (1)

AA Sequence

MVSGLRLASRSGEEGWLKPAVARLGPPRHRLRNLRTESPWRSRGSVLFCSGPGRAGRAAEPLHPVCTCGR      1 - 70
HFRRPEPCREPLASPIQDSVAFEDVAVNFTQEEWALLDSSQKNLYREVMQETCRNLASVGSQWKDQNIED     71 - 140
HFEKPGKDIRNHIVQRLCESKEDGQYGEVVSQIPNLDLNENISTGLKPCECSICGKVFVRHSLLNRHILA    141 - 210
HSGYKPYGEKQYKCEQCGKFFVSVPGVRRHMIMHSGNPAYKCTICGKAFYFLNSVERHQRTHTGEKPYKC    211 - 280
KQCGKAFTVSGSCLIHERTHTGEKPYECKECGKTFRFSCSFKTHERTHTGERPYKCTKCDKAFSCSTSLR    281 - 350
YHGSIHTGERPYECKQCGKAFSRLSSLCNHRSTHTGEKPYECKQCDQAFSRLSSLHLHERIHTGEKPYEC    351 - 420
KKCGKAYTRSSHLTRHERSHDIEAGCSDSAYNPSTLGGQGVWIA                              421 - 464
//

Text Mined References (4)

PMID Year Title