Property Summary

NCBI Gene PubMed Count 6
PubMed Score 8.61
PubTator Score 2.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Cytochrome-c Oxidase Deficiency 17 0.0 0.0
Disease Target Count P-value
atypical teratoid / rhabdoid tumor 5112 9.6e-05
ulcerative colitis 1819 1.1e-04
osteosarcoma 7950 1.8e-04
psoriasis 6694 5.7e-04
lung cancer 4740 2.0e-03
astrocytic glioma 2597 2.8e-02
oligodendroglioma 2850 4.5e-02
ependymoma 4679 4.9e-02
Disease Target Count Z-score Confidence
Cholera 34 3.075 1.5

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma -1.200 2.8e-02
atypical teratoid / rhabdoid tumor -1.400 9.6e-05
ependymoma -1.300 4.9e-02
lung cancer 2.200 2.0e-03
oligodendroglioma -1.100 4.5e-02
osteosarcoma 1.386 1.8e-04
psoriasis 1.500 5.7e-04
ulcerative colitis -1.100 1.1e-04

Gene RIF (3)

AA Sequence

MAGMVDFQDEEQVKSFLENMEVECNYHCYHEKDPDGCYRLVDYLEGIRKNFDEAAKVLKFNCEENQHSDS      1 - 70
CYKLGAYYVTGKGGLTQDLKAAARCFLMACEKPGKKSIAACHNVGLLAHDGQVNEDGQPDLGKARDYYTR     71 - 140
ACDGGYTSSCFNLSAMFLQGAPGFPKDMDLACKYSMKACDLGHIWACANASRMYKLGDGVDKDEAKAEVL    141 - 210
KNRAQQLHKEQQKGVQPLTFG                                                     211 - 231
//

Text Mined References (10)

PMID Year Title