Property Summary

NCBI Gene PubMed Count 6
PubMed Score 8.61
PubTator Score 2.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4369 9.63434408738352E-5
ulcerative colitis 2087 1.08988679858113E-4
osteosarcoma 7933 1.78848181138596E-4
psoriasis 6685 5.6539185395383E-4
lung cancer 4473 0.0019754200762054
astrocytic glioma 2241 0.0284727941386229
oligodendroglioma 2849 0.045321011628284
ependymoma 2514 0.049145383901915
Disease Target Count Z-score Confidence
Cholera 33 3.036 1.5

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma -1.200 0.028
ependymoma -1.300 0.049
oligodendroglioma -1.100 0.045
psoriasis 1.500 0.001
osteosarcoma 1.386 0.000
atypical teratoid / rhabdoid tumor -1.400 0.000
lung cancer 2.200 0.002
ulcerative colitis -1.100 0.000

Synonym

Accession Q96BR5 Q0P6I7 Q9H9Z9
Symbols RESA1
SELRC1
C1orf163

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG
Opossum OMA EggNOG
Platypus OMA EggNOG
Anole lizard OMA EggNOG
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid
Fruitfly EggNOG Inparanoid

Gene RIF (2)

PMID Text
24333015 C1orf163 is a novel factor important for the assembly of respiratory chain complexes in human mitochondria.
19460752 Knockdown of Sel1 repeat containing 1 (SELRC1; C1orf163) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells

AA Sequence

MAGMVDFQDEEQVKSFLENMEVECNYHCYHEKDPDGCYRLVDYLEGIRKNFDEAAKVLKFNCEENQHSDS      1 - 70
CYKLGAYYVTGKGGLTQDLKAAARCFLMACEKPGKKSIAACHNVGLLAHDGQVNEDGQPDLGKARDYYTR     71 - 140
ACDGGYTSSCFNLSAMFLQGAPGFPKDMDLACKYSMKACDLGHIWACANASRMYKLGDGVDKDEAKAEVL    141 - 210
KNRAQQLHKEQQKGVQPLTFG                                                     211 - 231
//

Text Mined References (10)

PMID Year Title
27683825 2016 COA7 (C1orf163/RESA1) mutations associated with mitochondrial leukoencephalopathy and cytochrome c oxidase deficiency.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24333015 2014 C1orf163/RESA1 is a novel mitochondrial intermembrane space protein connected to respiratory chain assembly.
21269460 2011 Initial characterization of the human central proteome.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.