Property Summary

NCBI Gene PubMed Count 6
PubMed Score 8.61
PubTator Score 2.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma -1.200 0.028
ependymoma -1.300 0.049
oligodendroglioma -1.100 0.045
psoriasis 1.500 0.001
osteosarcoma 1.386 0.000
atypical teratoid / rhabdoid tumor -1.400 0.000
lung cancer 2.200 0.002
ulcerative colitis -1.100 0.000

Gene RIF (2)

PMID Text
24333015 C1orf163 is a novel factor important for the assembly of respiratory chain complexes in human mitochondria.
19460752 Knockdown of Sel1 repeat containing 1 (SELRC1; C1orf163) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells

AA Sequence

MAGMVDFQDEEQVKSFLENMEVECNYHCYHEKDPDGCYRLVDYLEGIRKNFDEAAKVLKFNCEENQHSDS      1 - 70
CYKLGAYYVTGKGGLTQDLKAAARCFLMACEKPGKKSIAACHNVGLLAHDGQVNEDGQPDLGKARDYYTR     71 - 140
ACDGGYTSSCFNLSAMFLQGAPGFPKDMDLACKYSMKACDLGHIWACANASRMYKLGDGVDKDEAKAEVL    141 - 210
KNRAQQLHKEQQKGVQPLTFG                                                     211 - 231
//

Text Mined References (10)

PMID Year Title
27683825 2016 COA7 (C1orf163/RESA1) mutations associated with mitochondrial leukoencephalopathy and cytochrome c oxidase deficiency.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24333015 2014 C1orf163/RESA1 is a novel mitochondrial intermembrane space protein connected to respiratory chain assembly.
21269460 2011 Initial characterization of the human central proteome.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.