Property Summary

NCBI Gene PubMed Count 45
Grant Count 37
R01 Count 35
Funding $2,521,299.63
PubMed Score 51.83
PubTator Score 24.25

Knowledge Summary

Patent (12,531)

Expression

  Differential Expression (7)

Disease log2 FC p
group 4 medulloblastoma -1.800 0.000
medulloblastoma, large-cell -2.500 0.000
intraductal papillary-mucinous carcinoma... -1.100 0.001
breast carcinoma 1.300 0.001
Pick disease -1.100 0.002
progressive supranuclear palsy -1.700 0.014
ovarian cancer -1.800 0.000

Gene RIF (30)

PMID Text
26573229 Data show that activation of serum- and glucocorticoid-regulated kinase 3 (SGK3) plays an important role in inositol polyphosphate 4-phosphatase type II (INPP4B)-mediated melanoma cell proliferation.
25837824 It is unlikely that SGK3 plays a significant role for oncogenic signalling in multiple myeloma.
25712345 SGK3 is a key mediator of PDK1 activity in melanoma.
25458846 Breast cancers harboring oncogenic PIK3CA activate SGK3 signaling while suppressing Akt, indicative of oncogenic functions for both INPP4B and SGK3 in these tumors.
25395352 VPS34-IN1 will provide a useful tool to decipher the kinase-dependent functions of Vps34, with acute changes in SGK3 phosphorylation and subcellular localization being new biomarkers of Vps34 activity
24739041 SGK3 is an androgen receptor (AR) target and induces cell proliferation through the AR-SGK3-p70S6K-cyclin D1 pathway in prostate cancer cells.
24556932 SGK3 is a novel regulator of K(ir)2.1.
24379398 SGK3 stability and kinase activation are regulated by the Hsp90-Cdc37 chaperone complex.
23589291 SGK1,3 enhances the expression level of mature hERG channels by inhibiting Nedd4-2 as well as by promoting Rab11-mediated hERG recycling.
22576469 A positive correlation between SGK3 expression and breast tumor prognosis.
More...

AA Sequence

MQRDHTMDYKESCPSVSIPSSDEHREKKKRFTVYKVLVSVGRSEWFVFRRYAEFDKLYNTLKKQFPAMAL      1 - 70
KIPAKRIFGDNFDPDFIKQRRAGLNEFIQNLVRYPELYNHPDVRAFLQMDSPKHQSDPSEDEDERSSQKL     71 - 140
HSTSQNINLGPSGNPHAKPTDFDFLKVIGKGSFGKVLLAKRKLDGKFYAVKVLQKKIVLNRKEQKHIMAE    141 - 210
RNVLLKNVKHPFLVGLHYSFQTTEKLYFVLDFVNGGELFFHLQRERSFPEHRARFYAAEIASALGYLHSI    211 - 280
KIVYRDLKPENILLDSVGHVVLTDFGLCKEGIAISDTTTTFCGTPEYLAPEVIRKQPYDNTVDWWCLGAV    281 - 350
LYEMLYGLPPFYCRDVAEMYDNILHKPLSLRPGVSLTAWSILEELLEKDRQNRLGAKEDFLEIQNHPFFE    351 - 420
SLSWADLVQKKIPPPFNPNVAGPDDIRNFDTAFTEETVPYSVCVSSDYSIVNASVLEADDAFVGFSYAPP    421 - 490
SEDLFL                                                                    491 - 496
//

Text Mined References (57)

PMID Year Title
26573229 2015 INPP4B is upregulated and functions as an oncogenic driver through SGK3 in a subset of melanomas.
25837824 2015 Loss of serum and glucocorticoid-regulated kinase 3 (SGK3) does not affect proliferation and survival of multiple myeloma cell lines.
25712345 2015 PDK1 and SGK3 Contribute to the Growth of BRAF-Mutant Melanomas and Are Potential Therapeutic Targets.
25458846 2014 SGK3 mediates INPP4B-dependent PI3K signaling in breast cancer.
25395352 2014 Cinderella finds her shoe: the first Vps34 inhibitor uncovers a new PI3K-AGC protein kinase connection.
24739041 2014 SGK3 is an androgen-inducible kinase promoting prostate cancer cell proliferation through activation of p70 S6 kinase and up-regulation of cyclin D1.
24556932 2014 Up-regulation of Kir2.1 (KCNJ2) by the serum & glucocorticoid inducible SGK3.
24379398 2014 Coordinated regulation of serum- and glucocorticoid-inducible kinase 3 by a C-terminal hydrophobic motif and Hsp90-Cdc37 chaperone complex.
23589291 2013 The serum- and glucocorticoid-inducible kinases SGK1 and SGK3 regulate hERG channel expression via ubiquitin ligase Nedd4-2 and GTPase Rab11.
22576469 2012 SGK3 is associated with estrogen receptor expression in breast cancer.
More...