Property Summary

Ligand Count 2
NCBI Gene PubMed Count 46
PubMed Score 58.06
PubTator Score 24.25

Knowledge Summary

Patent (12,531)

Expression

  Differential Expression (7)

Disease log2 FC p
breast carcinoma 1.300 1.1e-03
group 3 medulloblastoma -1.200 3.4e-02
intraductal papillary-mucinous carcinoma... -1.100 9.8e-04
medulloblastoma, large-cell -2.500 2.1e-05
ovarian cancer -1.800 5.7e-09
Pick disease -1.100 2.1e-03
progressive supranuclear palsy -1.700 1.4e-02

Protein-protein Interaction (4)

Gene RIF (31)

AA Sequence

MQRDHTMDYKESCPSVSIPSSDEHREKKKRFTVYKVLVSVGRSEWFVFRRYAEFDKLYNTLKKQFPAMAL      1 - 70
KIPAKRIFGDNFDPDFIKQRRAGLNEFIQNLVRYPELYNHPDVRAFLQMDSPKHQSDPSEDEDERSSQKL     71 - 140
HSTSQNINLGPSGNPHAKPTDFDFLKVIGKGSFGKVLLAKRKLDGKFYAVKVLQKKIVLNRKEQKHIMAE    141 - 210
RNVLLKNVKHPFLVGLHYSFQTTEKLYFVLDFVNGGELFFHLQRERSFPEHRARFYAAEIASALGYLHSI    211 - 280
KIVYRDLKPENILLDSVGHVVLTDFGLCKEGIAISDTTTTFCGTPEYLAPEVIRKQPYDNTVDWWCLGAV    281 - 350
LYEMLYGLPPFYCRDVAEMYDNILHKPLSLRPGVSLTAWSILEELLEKDRQNRLGAKEDFLEIQNHPFFE    351 - 420
SLSWADLVQKKIPPPFNPNVAGPDDIRNFDTAFTEETVPYSVCVSSDYSIVNASVLEADDAFVGFSYAPP    421 - 490
SEDLFL                                                                    491 - 496
//

Text Mined References (58)

PMID Year Title