Property Summary

NCBI Gene PubMed Count 11
PubMed Score 23.07
PubTator Score 16.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Schizophrenia 503
Disease Target Count P-value
psoriasis 6685 3.3870355423015E-27
non-inflammatory breast cancer 208 8.07787932517043E-9
nasopharyngeal carcinoma 1056 3.52036003635083E-7
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00480646025409566
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00818976004999265
breast carcinoma 1614 0.0131603628162508
pancreatic cancer 2300 0.0235745421437914
Disease Target Count Z-score Confidence
Scheuermann's disease 10 4.75 2.4
Lipomatosis 11 3.218 1.6

Expression

Gene RIF (4)

PMID Text
22226334 Fam3D is a gut-derived protein that is expressed and secreted in a nutritional status-dependent manner
20677014 Statistical analysis indicated that six genes, NFATC2, SCP2, CACNA1C, TCRA, POLE, and FAM3D, were associated with narcolepsy.
20677014 Observational study of gene-disease association. (HuGE Navigator)
12160727 A cytokine-like protein found in placenta

AA Sequence

MRVSGVLRLLALIFAIVTTWMFIRSYMSFSMKTIRLPRWLAASPTKEIQVKKYKCGLIKPCPANYFAFKI      1 - 70
CSGAANVVGPTMCFEDRMIMSPVKNNVGRGLNIALVNGTTGAVLGQKAFDMYSGDVMHLVKFLKEIPGGA     71 - 140
LVLVASYDDPGTKMNDESRKLFSDLGSSYAKQLGFRDSWVFIGAKDLRGKSPFEQFLKNSPDTNKYEGWP    141 - 210
ELLEMEGCMPPKPF                                                            211 - 224
//

Text Mined References (12)

PMID Year Title
26966188 2016 Identification of FAM3D as a new endogenous chemotaxis agonist for the formyl peptide receptors.
22226334 2012 Oit1/Fam3D, a gut-secreted protein displaying nutritional status-dependent regulation.
21822266 2011 Exome sequencing supports a de novo mutational paradigm for schizophrenia.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16740002 2006 Identification of N-linked glycoproteins in human saliva by glycoprotein capture and mass spectrometry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...