Property Summary

NCBI Gene PubMed Count 11
PubMed Score 23.71
PubTator Score 16.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (7)

Disease log2 FC p
Breast cancer -1.400 6.8e-12
breast carcinoma -1.400 1.3e-02
intraductal papillary-mucinous carcinoma... 2.700 8.2e-03
intraductal papillary-mucinous neoplasm ... 2.400 4.8e-03
nasopharyngeal carcinoma -1.900 3.5e-07
pancreatic cancer 1.100 2.4e-02
psoriasis 1.600 3.4e-27

Gene RIF (5)

AA Sequence

MRVSGVLRLLALIFAIVTTWMFIRSYMSFSMKTIRLPRWLAASPTKEIQVKKYKCGLIKPCPANYFAFKI      1 - 70
CSGAANVVGPTMCFEDRMIMSPVKNNVGRGLNIALVNGTTGAVLGQKAFDMYSGDVMHLVKFLKEIPGGA     71 - 140
LVLVASYDDPGTKMNDESRKLFSDLGSSYAKQLGFRDSWVFIGAKDLRGKSPFEQFLKNSPDTNKYEGWP    141 - 210
ELLEMEGCMPPKPF                                                            211 - 224
//

Text Mined References (12)

PMID Year Title