Property Summary

NCBI Gene PubMed Count 11
PubMed Score 23.07
PubTator Score 16.32

Knowledge Summary

Patent

No data available

Expression

Gene RIF (4)

PMID Text
22226334 Fam3D is a gut-derived protein that is expressed and secreted in a nutritional status-dependent manner
20677014 Statistical analysis indicated that six genes, NFATC2, SCP2, CACNA1C, TCRA, POLE, and FAM3D, were associated with narcolepsy.
20677014 Observational study of gene-disease association. (HuGE Navigator)
12160727 A cytokine-like protein found in placenta

AA Sequence

MRVSGVLRLLALIFAIVTTWMFIRSYMSFSMKTIRLPRWLAASPTKEIQVKKYKCGLIKPCPANYFAFKI      1 - 70
CSGAANVVGPTMCFEDRMIMSPVKNNVGRGLNIALVNGTTGAVLGQKAFDMYSGDVMHLVKFLKEIPGGA     71 - 140
LVLVASYDDPGTKMNDESRKLFSDLGSSYAKQLGFRDSWVFIGAKDLRGKSPFEQFLKNSPDTNKYEGWP    141 - 210
ELLEMEGCMPPKPF                                                            211 - 224
//

Text Mined References (12)

PMID Year Title
26966188 2016 Identification of FAM3D as a new endogenous chemotaxis agonist for the formyl peptide receptors.
22226334 2012 Oit1/Fam3D, a gut-secreted protein displaying nutritional status-dependent regulation.
21822266 2011 Exome sequencing supports a de novo mutational paradigm for schizophrenia.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16740002 2006 Identification of N-linked glycoproteins in human saliva by glycoprotein capture and mass spectrometry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...