Property Summary

NCBI Gene PubMed Count 8
PubMed Score 9.12
PubTator Score 2.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 4.4e-12
malignant mesothelioma 3232 2.1e-07
Pick disease 1894 2.0e-05
group 3 medulloblastoma 4104 9.4e-04
progressive supranuclear palsy 676 3.7e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (5)

Disease log2 FC p
group 3 medulloblastoma 1.200 9.4e-04
malignant mesothelioma 1.500 2.1e-07
ovarian cancer -2.400 4.4e-12
Pick disease -1.400 2.0e-05
progressive supranuclear palsy -1.900 3.7e-03

Gene RIF (1)

AA Sequence

MAAESGSDFQQRRRRRRDPEEPEKTELSERELAVAVAVSQENDEENEERWVGPLPVEATLAKKRKVLEFE      1 - 70
RVYLDNLPSASMYERSYMHRDVITHVVCTKTDFIITASHDGHVKFWKKIEEGIEFVKHFRSHLGVIESIA     71 - 140
VSSEGALFCSVGDDKAMKVFDVVNFDMINMLKLGYFPGQCEWIYCPGDAISSVAASEKSTGKIFIYDGRG    141 - 210
DNQPLHIFDKLHTSPLTQIRLNPVYKAVVSSDKSGMIEYWTGPPHEYKFPKNVNWEYKTDTDLYEFAKCK    211 - 280
AYPTSVCFSPDGKKIATIGSDRKVRIFRFVTGKLMRVFDESLSMFTELQQMRQQLPDMEFGRRMAVEREL    281 - 350
EKVDAVRLINIVFDETGHFVLYGTMLGIKVINVETNRCVRILGKQENIRVMQLALFQGIAKKHRAATTIE    351 - 420
MKASENPVLQNIQADPTIVCTSFKKNRFYMFTKREPEDTKSADSDRDVFNEKPSKEEVMAATQAEGPKRV    421 - 490
SDSAIIHTSMGDIHTKLFPVECPKTVENFCVHSRNGYYNGHTFHRIIKGFMIQTGDPTGTGMGGESIWGG    491 - 560
EFEDEFHSTLRHDRPYTLSMANAGSNTNGSQFFITVVPTPWLDNKHTVFGRVTKGMEVVQRISNVKVNPK    561 - 630
TDKPYEDVSIINITVK                                                          631 - 646
//

Text Mined References (13)

PMID Year Title