Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.63
PubTator Score 2.78

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
breast carcinoma 1.800 0.001
diabetes mellitus -1.300 0.005
acute myeloid leukemia -1.200 0.015
ovarian cancer 3.500 0.000

Synonym

Accession Q96BP2
Symbols C2360
MRP-S37
C10orf34

Gene

PDB

3J9M  

 GO Function (1)

Gene RIF (4)

PMID Text
24137763 CHCHD1 mutations could not explain phenotype of patients with combined oxidative phosphorylation system deficiencies.
22190034 HIV-1 Rev is identified to have a physical interaction with coiled-coil-helix-coiled-coil-helix domain containing 1 (CHCHD1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
20877624 Observational study of gene-disease association. (HuGE Navigator)
15177562 C2360, a nuclear protein expressed in cytotrophoblasts, is a representative member of a multifamily of proteins, sharing a protein domain that is conserved in eukaryotes.

AA Sequence

MATPSLRGRLARFGNPRKPVLKPNKPLILANRVGERRREKGEATCITEMSVMMACWKQNEFRDDACRKEI      1 - 70
QGFLDCAARAQEARKMRSIQETLGESGSLLPNKLNKLLQRFPNKPYLS                           71 - 118
//

Text Mined References (12)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24137763 2010 Sequence variants in four candidate genes (NIPSNAP1, GBAS, CHCHD1 and METT11D1) in patients with combined oxidative phosphorylation system deficiencies.
23908630 2013 Identification and characterization of CHCHD1, AURKAIP1, and CRIF1 as new members of the mammalian mitochondrial ribosome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22190034 2011 Global landscape of HIV-human protein complexes.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...