Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.63
PubTator Score 2.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 2.4e-07
breast carcinoma 1638 6.6e-04
diabetes mellitus 1728 4.7e-03
acute myeloid leukemia 783 1.5e-02

Expression

  Differential Expression (4)

Disease log2 FC p
acute myeloid leukemia -1.200 1.5e-02
breast carcinoma 1.800 6.6e-04
diabetes mellitus -1.300 4.7e-03
ovarian cancer 3.500 2.4e-07

Synonym

Accession Q96BP2
Symbols C2360
MRP-S37
C10orf34

Gene

PDB

3J9M  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Function (1)

Gene RIF (4)

AA Sequence

MATPSLRGRLARFGNPRKPVLKPNKPLILANRVGERRREKGEATCITEMSVMMACWKQNEFRDDACRKEI      1 - 70
QGFLDCAARAQEARKMRSIQETLGESGSLLPNKLNKLLQRFPNKPYLS                           71 - 118
//

Text Mined References (13)

PMID Year Title