Property Summary

NCBI Gene PubMed Count 17
PubMed Score 7.78
PubTator Score 8.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma 1.100 0.003
ependymoma 1.200 0.008
oligodendroglioma 1.100 0.003
tuberculosis -1.900 0.000
intraductal papillary-mucinous adenoma (... 1.400 0.006
intraductal papillary-mucinous carcinoma... 1.100 0.006
interstitial cystitis 1.100 0.031
ovarian cancer 1.600 0.000

Synonym

Accession Q96BN8 D3DTD3 Q8NAS0 Q96IA3
Symbols GUM
AIPDS
FAM105B

Gene

PDB

3ZNZ   4KSK   4KSL   4OYK   4P0B   3ZNV   3ZNX   4KSJ  

Gene RIF (7)

PMID Text
24726327 HOIP binding to OTULIN is required for the recruitment of OTULIN to the TNF receptor complex.
24726323 Phosphorylation of OTULIN prevents HOIP binding, whereas unphosphorylated OTULIN is part of the endogenous LUBAC complex.
24461064 cylindromatosis (CYLD) and OTULIN/Gumby/Fam105B, directly interact with the N-terminal PUB domain-containing region of HOIP.
23806334 OTULIN restricts Met1-ubiquitin formation after immune receptor stimulation to prevent unwarranted proinflammatory signaling.
23746843 reveal a previously unannotated human DUB, OTULIN (also known as FAM105B), which is exquisitely specific for Met1 linkages; data suggest that OTULIN regulates Met1-polyUb signaling.
23708998 2.4 A and 2.8 A crystal structures of gumby (Fam105b) in the presence of free ubiquitin and linear diubiquitin substrate, respectively
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MSRGTMPQPEAWPGASCAETPAREAAATARDGGKAAASGQPRPEMQCPAEHEEDMYRAADEIEKEKELLI      1 - 70
HERGASEPRLSVAPEMDIMDYCKKEWRGNTQKATCMKMGYEEVSQKFTSIRRVRGDNYCALRATLFQAMS     71 - 140
QAVGLPPWLQDPELMLLPEKLISKYNWIKQWKLGLKFDGKNEDLVDKIKESLTLLRKKWAGLAEMRTAEA    141 - 210
RQIACDELFTNEAEEYSLYEAVKFLMLNRAIELYNDKEKGKEVPFFSVLLFARDTSNDPGQLLRNHLNQV    211 - 280
GHTGGLEQVEMFLLAYAVRHTIQVYRLSKYNTEEFITVYPTDPPKDWPVVTLIAEDDRHYNIPVRVCEET    281 - 350
SL                                                                        351 - 352
//

Text Mined References (20)

PMID Year Title
27559085 2016 Biallelic hypomorphic mutations in a linear deubiquitinase define otulipenia, an early-onset autoinflammatory disease.
27523608 2016 The Deubiquitinase OTULIN Is an Essential Negative Regulator of Inflammation and Autoimmunity.
26997266 2016 CYLD Limits Lys63- and Met1-Linked Ubiquitin at Receptor Complexes to Regulate Innate Immune Signaling.
26670046 2015 LUBAC-Recruited CYLD and A20 Regulate Gene Activation and Cell Death by Exerting Opposing Effects on Linear Ubiquitin in Signaling Complexes.
25416956 2014 A proteome-scale map of the human interactome network.
24726327 2014 Binding of OTULIN to the PUB domain of HOIP controls NF-?B signaling.
24726323 2014 Molecular basis and regulation of OTULIN-LUBAC interaction.
24461064 2014 Suppression of LUBAC-mediated linear ubiquitination by a specific interaction between LUBAC and the deubiquitinases CYLD and OTULIN.
23827681 2013 OTU deubiquitinases reveal mechanisms of linkage specificity and enable ubiquitin chain restriction analysis.
23806334 2013 OTULIN restricts Met1-linked ubiquitination to control innate immune signaling.
More...