Property Summary

NCBI Gene PubMed Count 17
PubMed Score 11.01
PubTator Score 8.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma 1.100 3.4e-03
ependymoma 1.200 8.2e-03
interstitial cystitis 1.100 3.1e-02
intraductal papillary-mucinous adenoma (... 1.400 5.6e-03
intraductal papillary-mucinous carcinoma... 1.100 5.7e-03
oligodendroglioma 1.100 2.9e-03
ovarian cancer -1.500 8.9e-09
tuberculosis -1.500 9.6e-08

Protein-protein Interaction (2)

Gene RIF (8)

AA Sequence

MSRGTMPQPEAWPGASCAETPAREAAATARDGGKAAASGQPRPEMQCPAEHEEDMYRAADEIEKEKELLI      1 - 70
HERGASEPRLSVAPEMDIMDYCKKEWRGNTQKATCMKMGYEEVSQKFTSIRRVRGDNYCALRATLFQAMS     71 - 140
QAVGLPPWLQDPELMLLPEKLISKYNWIKQWKLGLKFDGKNEDLVDKIKESLTLLRKKWAGLAEMRTAEA    141 - 210
RQIACDELFTNEAEEYSLYEAVKFLMLNRAIELYNDKEKGKEVPFFSVLLFARDTSNDPGQLLRNHLNQV    211 - 280
GHTGGLEQVEMFLLAYAVRHTIQVYRLSKYNTEEFITVYPTDPPKDWPVVTLIAEDDRHYNIPVRVCEET    281 - 350
SL                                                                        351 - 352
//

Text Mined References (20)

PMID Year Title