Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.07
PubTator Score 0.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.600 3.4e-04
aldosterone-producing adenoma -1.189 7.9e-03
atypical teratoid / rhabdoid tumor -1.200 2.8e-04
glioblastoma -1.400 2.0e-04
group 4 medulloblastoma -1.100 6.6e-03
medulloblastoma, large-cell -1.700 2.1e-03
osteosarcoma -2.192 8.2e-07
ovarian cancer -1.400 2.9e-06
spina bifida -1.290 3.0e-02

AA Sequence

MISRYTRKAVPQSLELKGITKHALNHHPPPEKLEEISPTSDSHEKDTSSQSKSDITRESSFTSADTGNSL      1 - 70
SAFPSYTGAGISTEGSSDFSWGYGELDQNATEKVQTMFTAIDELLYEQKLSVHTKSLQEECQQWTASFPH     71 - 140
LRILGRQIITPSEGYRLYPRSPSAVSASYETTLSQERDSTIFGIRGKKLHFSSSYAHKASSIAKSSSFCS    141 - 210
MERDEEDSIIVSEGIIEEYLAFDHIDIEEGFHGKKSEAATEKQKLGYPPIAPFYCMKEDVLAYVFDSVWC    211 - 280
KVVSCMEQLTRSHWEGFASDDESNVAVTRPDSESSCVLSELHPLVLPRVPQSKVLYITSNPMSLCQASRH    281 - 350
QPNVNDLLVHGMPLQPRNLSLMDKLLDLDDKLLMRPGSSTILSTRNWPNRAVEFSTSSLSYTVQSTRRRN    351 - 420
PPPRTLHPISTSHSCAETPRSVEEILRGARVPVAPDSLSSPSPTPLSRNNLLPPIGTAEVEHVSTVGPQR    421 - 490
QMKPHGDSSRAQSAVVDEPNYQQPQERLLLPDFFPRPNTTQSFLLDTQYRRSCAVEYPHQARPGRGSAGP    491 - 560
QLHGSTKSQSGGRPVSRTRQGP                                                    561 - 582
//

Text Mined References (6)

PMID Year Title