Property Summary

NCBI Gene PubMed Count 16
PubMed Score 11.21
PubTator Score 1.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
primary pancreatic ductal adenocarcinoma 1.194 0.001

Synonym

Accession Q96BM9 B3KXD0
Symbols GIE2
ARL10B

Gene

PDB

1ZD9   2H18   4ILE  

Gene RIF (2)

PMID Text
16537643 Overexpression of Arl8a or Arl8b results in a microtubule-dependent redistribution of lysosomes towards the cell periphery. Live cell imaging suggested a role for Arl8a and Arl8b as positive regulators of lysosomal transport.[Ar18a] [Ar18b]
15331635 Results suggest that the novel GTPases Gie1 and Gie2 associate with microtubules, and might be involved in chromosome segregation.

AA Sequence

MIALFNKLLDWFKALFWKEEMELTLVGLQYSGKTTFVNVIASGQFNEDMIPTVGFNMRKITKGNVTIKLW      1 - 70
DIGGQPRFRSMWERYCRGVSAIVYMVDAADQEKIEASKNELHNLLDKPQLQGIPVLVLGNKRDLPGALDE     71 - 140
KELIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSKSRRS                            141 - 186
//

Text Mined References (20)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24955142 2014 Exploration of panviral proteome: high-throughput cloning and functional implications in virus-host interactions.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
19946888 2010 Defining the membrane proteome of NK cells.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
17897319 2007 Integral and associated lysosomal membrane proteins.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
More...