Property Summary

NCBI Gene PubMed Count 17
PubMed Score 12.14
PubTator Score 1.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Liver Cirrhosis, Experimental 769 0.0 0.0
Disease Target Count P-value
primary pancreatic ductal adenocarcinoma 1109 1.1e-03
Disease Target Count Z-score Confidence
Cortical blindness 16 4.096 2.0
Protein C deficiency 19 3.043 1.5

Expression

  Differential Expression (1)

Disease log2 FC p
primary pancreatic ductal adenocarcinoma 1.194 1.1e-03

Gene RIF (2)

AA Sequence

MIALFNKLLDWFKALFWKEEMELTLVGLQYSGKTTFVNVIASGQFNEDMIPTVGFNMRKITKGNVTIKLW      1 - 70
DIGGQPRFRSMWERYCRGVSAIVYMVDAADQEKIEASKNELHNLLDKPQLQGIPVLVLGNKRDLPGALDE     71 - 140
KELIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSKSRRS                            141 - 186
//

Text Mined References (21)

PMID Year Title