Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Juvenile arthritis 124
Disease Target Count P-value
pilocytic astrocytoma 3086 1.45315949181915E-8
ovarian cancer 8492 2.86403382783493E-7
ulcerative colitis 2087 1.29509270897103E-6
atypical teratoid / rhabdoid tumor 4369 1.95800131532651E-6
medulloblastoma 1524 2.65458491788426E-6
medulloblastoma, large-cell 6234 2.33853018138901E-5
adult high grade glioma 2148 4.7366823436063E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 4.87645980309737E-5
glioblastoma 5572 4.88807361490826E-4
osteosarcoma 7933 0.00102296282239244
primitive neuroectodermal tumor 3031 0.00344819393518872
ependymoma 2514 0.023434087761416
primary Sjogren syndrome 789 0.0361859438804219
oligodendroglioma 2849 0.0421015513325516
astrocytic glioma 2241 0.0464211597204275

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma -1.800 0.046
ependymoma -2.500 0.023
oligodendroglioma -1.900 0.042
osteosarcoma -1.519 0.001
glioblastoma -2.200 0.000
medulloblastoma -2.700 0.000
atypical teratoid / rhabdoid tumor -2.100 0.000
medulloblastoma, large-cell -3.800 0.000
primitive neuroectodermal tumor -1.900 0.003
intraductal papillary-mucinous adenoma (... 1.400 0.000
adult high grade glioma -2.300 0.000
pilocytic astrocytoma -2.900 0.000
primary Sjogren syndrome -1.100 0.036
ulcerative colitis -1.800 0.000
ovarian cancer 3.100 0.000

Synonym

Accession Q96BM1 A8K753
Symbols

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid

 Compartment GO Term (1)

 GWAS Trait (1)

Pathway (1)

Gene RIF (1)

PMID Text
18187620 Knockdown of ankyrin repeat domain 9 (ANKRD9) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MPWDARRPGGGADGGPEASGAARSRAQKQCRKSSFAFYQAVRDLLPVWLLEDMRASEAFHWDERGRAAAY      1 - 70
SPSEALLYALVHDHQAYAHYLLATFPRRALAPPSAGFRCCAAPGPHVALAVRYNRVGILRRILRTLRDFP     71 - 140
AEERARVLDRRGCSRVEGGGTSLHVACELARPECLFLLLGHGASPGLRDGGGLTPLELLLRQLGRDAGAT    141 - 210
PSAAGAPASAPGEPRQRRLLLLDLLALYTPVGAAGSARQELLGDRPRWQRLLGEDKFQWLAGLAPPSLFA    211 - 280
RAMQVLVTAISPGRFPEALDELPLPPFLQPLDLTGKG                                     281 - 317
//

Text Mined References (5)

PMID Year Title
24952745 2014 Genetic association study of QT interval highlights role for calcium signaling pathways in myocardial repolarization.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.