Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.20

Knowledge Summary


No data available


  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -2.300 4.7e-05
astrocytic glioma -1.800 4.6e-02
Astrocytoma, Pilocytic -1.400 3.1e-08
atypical teratoid / rhabdoid tumor -2.100 2.0e-06
ependymoma -2.500 2.3e-02
glioblastoma -1.800 3.5e-05
group 3 medulloblastoma -1.200 5.7e-04
intraductal papillary-mucinous adenoma (... 1.400 4.9e-05
medulloblastoma, large-cell -1.700 3.4e-04
oligodendroglioma -1.900 4.2e-02
osteosarcoma -1.519 1.0e-03
ovarian cancer -1.100 4.2e-03
primary Sjogren syndrome -1.100 3.6e-02
primitive neuroectodermal tumor -1.900 3.4e-03
ulcerative colitis -1.800 1.3e-06


Accession Q96BM1 A8K753


  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GWAS Trait (1)

Gene RIF (1)

AA Sequence

RAMQVLVTAISPGRFPEALDELPLPPFLQPLDLTGKG                                     281 - 317

Text Mined References (5)

PMID Year Title