Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma -1.800 0.046
ependymoma -2.500 0.023
oligodendroglioma -1.900 0.042
osteosarcoma -1.519 0.001
glioblastoma -2.200 0.000
medulloblastoma -2.700 0.000
atypical teratoid / rhabdoid tumor -2.100 0.000
medulloblastoma, large-cell -3.800 0.000
primitive neuroectodermal tumor -1.900 0.003
intraductal papillary-mucinous adenoma (... 1.400 0.000
adult high grade glioma -2.300 0.000
pilocytic astrocytoma -2.900 0.000
primary Sjogren syndrome -1.100 0.036
ulcerative colitis -1.800 0.000
ovarian cancer 3.100 0.000

Gene RIF (1)

PMID Text
18187620 Knockdown of ankyrin repeat domain 9 (ANKRD9) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MPWDARRPGGGADGGPEASGAARSRAQKQCRKSSFAFYQAVRDLLPVWLLEDMRASEAFHWDERGRAAAY      1 - 70
SPSEALLYALVHDHQAYAHYLLATFPRRALAPPSAGFRCCAAPGPHVALAVRYNRVGILRRILRTLRDFP     71 - 140
AEERARVLDRRGCSRVEGGGTSLHVACELARPECLFLLLGHGASPGLRDGGGLTPLELLLRQLGRDAGAT    141 - 210
PSAAGAPASAPGEPRQRRLLLLDLLALYTPVGAAGSARQELLGDRPRWQRLLGEDKFQWLAGLAPPSLFA    211 - 280
RAMQVLVTAISPGRFPEALDELPLPPFLQPLDLTGKG                                     281 - 317
//

Text Mined References (5)

PMID Year Title
24952745 2014 Genetic association study of QT interval highlights role for calcium signaling pathways in myocardial repolarization.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.