Property Summary

NCBI Gene PubMed Count 8
PubMed Score 10.77

Knowledge Summary


No data available


  Disease (1)

Disease Target Count P-value
posterior fossa group B ependymoma 416 1.5e-12
osteosarcoma 7950 7.3e-06


  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.416 7.3e-06
posterior fossa group B ependymoma 1.100 1.5e-12

Gene RIF (1)

AA Sequence

LQSVGAAGLSVTSKVIGGFAGTALGAWLGSPPSS                                         71 - 104

Text Mined References (9)

PMID Year Title