Property Summary

NCBI Gene PubMed Count 8
PubMed Score 10.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 1.49901076528748E-12
osteosarcoma 7933 7.314253436583E-6

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.416 0.000
posterior fossa group B ependymoma 1.100 0.000

Synonym

Accession Q96BM0
Symbols FAM14B
ISG12C

Gene

PDB

2LOQ  

  Ortholog (2)

Species Source
Macaque OMA EggNOG Inparanoid
Chicken OMA Inparanoid

Gene RIF (1)

PMID Text
20237496 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGKESGWDSGRAAVAAVVGGVVAVGTVLVALSAMGFTSVGIAASSIAAKMMSTAAIANGGGVAAGSLVAI      1 - 70
LQSVGAAGLSVTSKVIGGFAGTALGAWLGSPPSS                                         71 - 104
//

Text Mined References (9)

PMID Year Title
22609626 2012 Facile backbone structure determination of human membrane proteins by NMR spectroscopy.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19260139 2009 Genome-wide association study of anthropometric traits in Korcula Island, Croatia.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15014966 2004 Sequence organization and matrix attachment regions of the human serine protease inhibitor gene cluster at 14q32.1.
14728724 2004 Identification of a novel gene family that includes the interferon-inducible human genes 6-16 and ISG12.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.