Property Summary

NCBI Gene PubMed Count 8
PubMed Score 10.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
posterior fossa group B ependymoma 416 1.5e-12
osteosarcoma 7950 7.3e-06

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.416 7.3e-06
posterior fossa group B ependymoma 1.100 1.5e-12

Synonym

Accession Q96BM0
Symbols FAM14B
ISG12C

Gene

PDB

2LOQ  

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG Inparanoid

Gene RIF (1)

AA Sequence

MGKESGWDSGRAAVAAVVGGVVAVGTVLVALSAMGFTSVGIAASSIAAKMMSTAAIANGGGVAAGSLVAI      1 - 70
LQSVGAAGLSVTSKVIGGFAGTALGAWLGSPPSS                                         71 - 104
//

Text Mined References (9)

PMID Year Title