Property Summary

NCBI Gene PubMed Count 54
Grant Count 26
R01 Count 21
Funding $2,777,155.19
PubMed Score 95.55
PubTator Score 63.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (1)

Disease log2 FC p
non primary Sjogren syndrome sicca 1.200 0.016

Gene RIF (40)

PMID Text
26261583 High PinX1 expression significantly correlated with a worse 5-year overall and disease-specific survival in gliomas.
26211574 PinX1 protein expression is decreased in colorectal cancer patients and predicts a poor prognosis.
26194824 The stability of PinX1 is maintained in nucleolus in the presence of TERT.
26187699 Data show a novel molecular mechanism for PINX1 as an attenuator of estrogen receptor activity in breast cancer cell lines, furthering its role as a tumor suppressor gene in breast cancer.
26033551 PinX1 negatively regulated ccRCC metastasis and the expression of MMP-2 and NF-kappaB-p65
25888829 PinX1 expression was an independent negative prognostic factor for breast cancer patients.
25746325 Two novel markers, rs7840785 (PINX1) and rs7844465 (ZHX2), are significantly associated with carotid intima-media thickness.
25698538 PinX1 inhibits cell proliferation, migration and invasion in glioma cells.
25045845 the expression of PinX1 in CSCC patients is likely a predictor of the response to paclitaxel chemotherapy.
24839934 Data confirmed that levels of PinX1 and caspase 3, 8 and 9 expression were closely linked to the poor prognosis of colorectal cancer.
More...

AA Sequence

MSMLAERRRKQKWAVDPQNTAWSNDDSKFGQRMLEKMGWSKGKGLGAQEQGATDHIKVQVKNNHLGLGAT      1 - 70
INNEDNWIAHQDDFNQLLAELNTCHGQETTDSSDKKEKKSFSLEEKSKISKNRVHYMKFTKGKDLSSRSK     71 - 140
TDLDCIFGKRQSKKTPEGDASPSTPEENETTTTSAFTIQEYFAKRMAALKNKPQVPVPGSDISETQVERK    141 - 210
RGKKRNKEATGKDVESYLQPKAKRHTEGKPERAEAQERVAKKKSAPAEEQLRGPCWDQSSKASAQDAGDH    211 - 280
VQPPEGRDFTLKPKKRRGKKKLQKPVEIAEDATLEETLVKKKKKKDSK                          281 - 328
//

Text Mined References (60)

PMID Year Title
26261583 2015 PinX1 is up-regulated and associated with poor patients' survival in gliomas.
26211574 2015 Decreased expression of PinX1 protein predicts poor prognosis of colorectal cancer patients receiving 5-FU adjuvant chemotherapy.
26194824 2015 Increased Stability of Nucleolar PinX1 in the Presence of TERT.
26187699 2015 Novel role for PINX1 as a coregulator of nuclear hormone receptors.
26033551 2015 PinX1 serves as a potential prognostic indicator for clear cell renal cell carcinoma and inhibits its invasion and metastasis by suppressing MMP-2 via NF-?B-dependent transcription.
25888829 2015 PinX1 inhibits the invasion and metastasis of human breast cancer via suppressing NF-?B/MMP-9 signaling pathway.
25746325 2015 Genetic association and gene-smoking interaction study of carotid intima-media thickness at five GWAS-indicated genes: the Bogalusa Heart Study.
25698538 2015 PinX1 inhibits cell proliferation, migration and invasion in glioma cells.
25045845 2014 The telomere/telomerase binding factor PinX1 regulates paclitaxel sensitivity depending on spindle assembly checkpoint in human cervical squamous cell carcinomas.
24839934 2014 PinX1 without the G-patch motif suppresses proliferation, induces senescence, but does not inhibit telomerase activity in colorectal cancer SW480 cells.
More...