Property Summary

NCBI Gene PubMed Count 10
PubMed Score 10.17
PubTator Score 5.00

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
ductal carcinoma in situ 1.400 1.3e-02
interstitial cystitis -1.700 9.8e-04
invasive ductal carcinoma 1.500 4.2e-02
osteosarcoma -2.989 4.6e-08
pancreatic ductal adenocarcinoma liver m... 1.130 9.0e-03
pituitary cancer -1.100 2.2e-04

Gene RIF (4)

AA Sequence

MAPPRNVVKIAIKMRDAIPQLIQLDQAKPLAAVLKEVCDAWSLTHSERYALQFADGHRRYITENNRAEIK      1 - 70
NGSILCLSTAPDLEAEQLLGGLQSNSPEGRREALRRLVPLASDMIFAREVISRNGLQILGTIIEDGDDLG     71 - 140
EVLALSLRAFSELMEHGVVSWETLSIPFVRKVVCYVNMNLMDASVPPLALGLLESVTLSSPALGQLVKSE    141 - 210
VPLDRLLVHLQVMNQQLQTKAMALLTALLQGASPVERKHMLDYLWQRNLRQFIYKNIIHSAAPMGDEMAH    211 - 280
HLYVLQALMLGLLEPRMRTPLDPYSQEQREQLQVLRQAAFEVEGESSGAGLSADRRRSLCAREFRKLGFS    281 - 350
NSNPAQDLERVPPGLLALDNMLYFSRNAPSAYSRFVLENSSREDKHECPFARGSIQLTVLLCELLRVGEP    351 - 420
CSETAQDFSPMFFGQDQSFHELFCVGIQLLNKTWKEMRATQEDFDKVMQVVREQLARTLALKPTSLELFR    421 - 490
TKVNALTYGEVLRLRQTERLHQEGTLAPPILELREKLKPELMGLIRQQRLLRLCEGTLFRKISSRRRQDK    491 - 560
LWFCCLSPNHKLLQYGDMEEGASPPTLESLPEQLPVADMRALLTGKDCPHVREKGSGKQNKDLYELAFSI    561 - 630
SYDRGEEEAYLNFIAPSKREFYLWTDGLSALLGSPMGSEQTRLDLEQLLTMETKLRLLELENVPIPERPP    631 - 700
PVPPPPTNFNFCYDCSIAEP                                                      701 - 720
//

Text Mined References (11)

PMID Year Title