Property Summary

NCBI Gene PubMed Count 8
PubMed Score 10.48
PubTator Score 5.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -2.989 0.000
pancreatic ductal adenocarcinoma liver m... 1.130 0.009
interstitial cystitis -2.100 0.000
ductal carcinoma in situ 1.400 0.013
invasive ductal carcinoma 1.500 0.042
pituitary cancer -1.100 0.000

Gene RIF (2)

PMID Text
26191257 The over-expression of ELMO3 was a potential diagnostic and prognostic marker for non-small cell lung cancer.
20127720 The present study reports the first characterization of the ELMO3 promoter and suggests a significant role of CDX2 in the basal transcriptional regulation of the intestine-specific expression of ELMO3, possibly through interaction with SP1.

AA Sequence

MAPPRNVVKIAIKMRDAIPQLIQLDQAKPLAAVLKEVCDAWSLTHSERYALQFADGHRRYITENNRAEIK      1 - 70
NGSILCLSTAPDLEAEQLLGGLQSNSPEGRREALRRLVPLASDMIFAREVISRNGLQILGTIIEDGDDLG     71 - 140
EVLALSLRAFSELMEHGVVSWETLSIPFVRKVVCYVNMNLMDASVPPLALGLLESVTLSSPALGQLVKSE    141 - 210
VPLDRLLVHLQVMNQQLQTKAMALLTALLQGASPVERKHMLDYLWQRNLRQFIYKNIIHSAAPMGDEMAH    211 - 280
HLYVLQALMLGLLEPRMRTPLDPYSQEQREQLQVLRQAAFEVEGESSGAGLSADRRRSLCAREFRKLGFS    281 - 350
NSNPAQDLERVPPGLLALDNMLYFSRNAPSAYSRFVLENSSREDKHECPFARGSIQLTVLLCELLRVGEP    351 - 420
CSETAQDFSPMFFGQDQSFHELFCVGIQLLNKTWKEMRATQEDFDKVMQVVREQLARTLALKPTSLELFR    421 - 490
TKVNALTYGEVLRLRQTERLHQEGTLAPPILELREKLKPELMGLIRQQRLLRLCEGTLFRKISSRRRQDK    491 - 560
LWFCCLSPNHKLLQYGDMEEGASPPTLESLPEQLPVADMRALLTGKDCPHVREKGSGKQNKDLYELAFSI    561 - 630
SYDRGEEEAYLNFIAPSKREFYLWTDGLSALLGSPMGSEQTRLDLEQLLTMETKLRLLELENVPIPERPP    631 - 700
PVPPPPTNFNFCYDCSIAEP                                                      701 - 720
//

Text Mined References (9)

PMID Year Title
26191257 2015 ELMO3 is a novel biomarker for diagnosis and prognosis of non-small cell lung cancer.
24567399 2014 G-protein coupled receptor BAI3 promotes myoblast fusion in vertebrates.
20127720 2010 Control of intestinal promoter activity of the cellular migratory regulator gene ELMO3 by CDX2 and SP1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11595183 2001 CED-12/ELMO, a novel member of the CrkII/Dock180/Rac pathway, is required for phagocytosis and cell migration.