Property Summary

NCBI Gene PubMed Count 28
PubMed Score 229.79
PubTator Score 32.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Gene RIF (16)

AA Sequence

MQGARAPRDQGRSPGRMSALGRSSVILLTYVLAATELTCLFMQFSIVPYLSRKLGLDSIAFGYLQTTFGV      1 - 70
LQLLGGPVFGRFADQRGARAALTLSFLAALALYLLLAAASSPALPGVYLLFASRLPGALMHTLPAAQMVI     71 - 140
TDLSAPEERPAALGRLGLCFGVGVILGSLLGGTLVSAYGIQCPAILAALATLLGAVLSFTCIPASTKGAK    141 - 210
TDAQAPLPGGPRASVFDLKAIASLLRLPDVPRIFLVKVASNCPTGLFMVMFSIISMDFFQLEAAQAGYLM    211 - 280
SFFGLLQMVTQGLVIGQLSSHFSEEVLLRASVLVFIVVGLAMAWMSSVFHFCLLVPGLVFSLCTLNVVTD    281 - 350
SMLIKAVSTSDTGTMLGLCASVQPLLRTLGPTVGGLLYRSFGVPVFGHVQVAINTLVLLVLWRKPMPQRK    351 - 420
DKVR                                                                      421 - 424
//

Text Mined References (28)

PMID Year Title