Property Summary

NCBI Gene PubMed Count 27
Grant Count 186
R01 Count 49
Funding $62,681,615.7
PubMed Score 206.17
PubTator Score 32.68

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q96BI1 O14906 O43562 O60485 O60680 Q7LDS5 Q7LGF7
Symbols HET
ITM
BWR1A
IMPT1
TSSC5
ORCTL2
BWSCR1A
SLC22A1L
p45-BWR1A

Gene

Gene RIF (15)

PMID Text
26196590 Establish SLC22A18 as a tumor suppressor in colon epithelial cells and propose that SLC22A18 is potentially a marker of diagnostic and prognostic values.
25498886 microRNA-137 functions as a tumor suppressor in human non-small cell lung cancer by targeting SLC22A18
24481489 Upregulated expression of SLC22A18 enhanced the radiosensitivity of glioma U251 cells.
23514245 SLC22A18 protein expression predicted a significantly shorter overall survival in 51 patients receiving TMZ therapy, whereas no differences in overall survival were observed in 35 patients without TMZ therapy
22237119 The expression level of SLC22A18 in non-small cell lung cancer was significantly higher than that in normal tissue.
22153794 SLC22A18 functions as a tumor suppressor in glioma and represents a candidate biomarker for long-term survival in this disease.
21936894 SLC22A18 downregulation via promoter methylation is associated with the development and progression of glioma.
21144813 Low expression of SLC22A18 was associated with tumor progression, recurrence and poor survival after breast surgery
20201924 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18996451 Mutational analysis of the two Sp1 sites suggested their requirement for the promoter activityof SLC22A18.
More...

AA Sequence

MQGARAPRDQGRSPGRMSALGRSSVILLTYVLAATELTCLFMQFSIVPYLSRKLGLDSIAFGYLQTTFGV      1 - 70
LQLLGGPVFGRFADQRGARAALTLSFLAALALYLLLAAASSPALPGVYLLFASRLPGALMHTLPAAQMVI     71 - 140
TDLSAPEERPAALGRLGLCFGVGVILGSLLGGTLVSAYGIQCPAILAALATLLGAVLSFTCIPASTKGAK    141 - 210
TDAQAPLPGGPRASVFDLKAIASLLRLPDVPRIFLVKVASNCPTGLFMVMFSIISMDFFQLEAAQAGYLM    211 - 280
SFFGLLQMVTQGLVIGQLSSHFSEEVLLRASVLVFIVVGLAMAWMSSVFHFCLLVPGLVFSLCTLNVVTD    281 - 350
SMLIKAVSTSDTGTMLGLCASVQPLLRTLGPTVGGLLYRSFGVPVFGHVQVAINTLVLLVLWRKPMPQRK    351 - 420
DKVR                                                                      421 - 424
//

Text Mined References (27)

PMID Year Title
26196590 2015 Characterization of SLC22A18 as a tumor suppressor and novel biomarker in colorectal cancer.
25498886 2015 microRNA-137 functions as a tumor suppressor in human non-small cell lung cancer by targeting SLC22A18.
24481489 2014 In vitro and in vivo radiosensitization of human glioma U251 cells induced by upregulated expression of SLC22A18.
23514245 2013 Predictive value of the SLC22A18 protein expression in glioblastoma patients receiving temozolomide therapy.
22237119 2012 [Expression and its clinical significance of SLC22A18 in non-small cell lung cancer].
22153794 2012 Correlation of low SLC22A18 expression with poor prognosis in patients with glioma.
21936894 2011 Promoter methylation and downregulation of SLC22A18 are associated with the development and progression of human glioma.
21144813 2011 Low expression of SLC22A18 predicts poor survival outcome in patients with breast cancer after surgery.
20705733 2010 Common variants in the calcium-sensing receptor gene are associated with total serum calcium levels.
20201924 2010 Genome-wide association study of alcohol dependence implicates a region on chromosome 11.
More...