Property Summary

NCBI Gene PubMed Count 10
PubMed Score 14.31
PubTator Score 42.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
group 3 medulloblastoma 4104 3.7e-03
psoriasis 6694 1.2e-02
Disease Target Count Z-score Confidence
Attention deficit hyperactivity disorder 278 0.0 3.0

Gene RIF (4)

AA Sequence

MTRWSSYLLGWTTFLLYSYESSGGMHEECVFPFTYKGSVYFTCTHIHSLSPWCATRAVYNGQWKYCQSED      1 - 70
YPRCIFPFIYRGKAYNSCISQGSFLGSLWCSVTSVFDEKQQWKFCETNEYGGNSLRKPCIFPSIYRNNVV     71 - 140
SDCMEDESNKLWCPTTENMDKDGKWSFCADTRISALVPGFPCHFPFNYKNKNYFNCTNEGSKENLVWCAT    141 - 210
SYNYDQDHTWVYC                                                             211 - 223
//

Text Mined References (12)

PMID Year Title