Property Summary

NCBI Gene PubMed Count 9
PubMed Score 287.83
PubTator Score 21.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
osteosarcoma 7933 0.00472119457865233
Disease Target Count Z-score Confidence
Congenital epulis 3 3.911 2.0
Mucoepidermoid carcinoma 19 3.596 1.8

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.115 0.005

Synonym

Accession Q96BH1 A8K0D6 Q53HQ5 Q9H874
Symbols AO7

Gene

PDB

5D1K   5D1L   5D1M   2DAY   2DMF  

  Ortholog (11)

Gene RIF (3)

PMID Text
26475854 mutations having marked effects on function only minimally affect the intermolecular interactions between the AO7 RING and UbcH5B, establishing a high degree of complexity in activation through the RING-E2 interface.
12748188 RING finger protein AO7 supports NF-kappaB-mediated transcription by interacting with the transactivation domain of the p65 subunit.
10500182 Functional studies of the mouse counterpart

AA Sequence

MAASASAAAGEEDWVLPSEVEVLESIYLDELQVIKGNGRTSPWEIYITLHPATAEDQDSQYVCFTLVLQV      1 - 70
PAEYPHEVPQISIRNPRGLSDEQIHTILQVLGHVAKAGLGTAMLYELIEKGKEILTDNNIPHGQCVICLY     71 - 140
GFQEKEAFTKTPCYHYFHCHCLARYIQHMEQELKAQGQEQEQERQHATTKQKAVGVQCPVCREPLVYDLA    141 - 210
SLKAAPEPQQPMELYQPSAESLRQQEERKRLYQRQQERGGIIDLEAERNRYFISLQQPPAPAEPESAVDV    211 - 280
SKGSQPPSTLAAELSTSPAVQSTLPPPLPVATQHICEKIPGTRSNQQRLGETQKAMLDPPKPSRGPWRQP    281 - 350
ERRHPKGGECHAPKGTRDTQELPPPEGPLKEPMDLKPEPHSQGVEGPPQEKGPGSWQGPPPRRTRDCVRW    351 - 420
ERSKGRTPGSSYPRLPRGQGAYRPGTRRESLGLESKDGS                                   421 - 459
//

Text Mined References (13)

PMID Year Title
26475854 2015 Insights into Ubiquitination from the Unique Clamp-like Binding of the RING E3 AO7 to the E2 UbcH5B.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690564 2009 A comprehensive framework of E2-RING E3 interactions of the human ubiquitin-proteasome system.
19549727 2009 Analysis of the human E2 ubiquitin conjugating enzyme protein interaction network.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12748188 2003 RING finger protein AO7 supports NF-kappaB-mediated transcription by interacting with the transactivation domain of the p65 subunit.
More...