Property Summary

NCBI Gene PubMed Count 7
Grant Count 2
Funding $406,844
PubMed Score 77.13
PubTator Score 19.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
psoriasis -1.300 0.000
osteosarcoma -1.904 0.001
group 4 medulloblastoma -4.200 0.000
astrocytoma 2.000 0.012
atypical teratoid / rhabdoid tumor -1.100 0.005
medulloblastoma, large-cell -4.900 0.000
primitive neuroectodermal tumor -1.300 0.036
acute quadriplegic myopathy 1.233 0.000
tuberculosis 2.300 0.000
non-small cell lung cancer -1.093 0.000
pilocytic astrocytoma 1.400 0.000
non primary Sjogren syndrome sicca 1.400 0.014
gastric carcinoma 1.100 0.028
invasive ductal carcinoma -1.700 0.007
ovarian cancer 2.300 0.000
dermatomyositis 1.700 0.000

Synonym

Accession Q96BF6 NAC-2
Symbols RBB
BEND9
NAC-2
BTBD14
BTBD31
BTBD14A

Gene

 Grant Application (2)

Gene RIF (3)

PMID Text
22926524 RBB is a novel transcriptional repressor and an important regulator of p53 pathway.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18976975 Knockdown of NACC family member 2, BEN and BTB (POZ) domain containing (NACC2) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells

AA Sequence

MSQMLHIEIPNFGNTVLGCLNEQRLLGLYCDVSIVVKGQAFKAHRAVLAASSLYFRDLFSGNSKSAFELP      1 - 70
GSVPPACFQQILSFCYTGRLTMTASEQLVVMYTAGFLQIQHIVERGTDLMFKVSSPHCDSQTAVIEDAGS     71 - 140
EPQSPCNQLQPAAAAAAPYVVSPSVPIPLLTRVKHEAMELPPAGPGLAPKRPLETGPRDGVAVAAGAAVA    141 - 210
AGTAPLKLPRVSYYGVPSLATLIPGIQQMPYPQGERTSPGASSLPTTDSPTSYHNEEDEEDDEAYDTMVE    211 - 280
EQYGQMYIKASGSYAVQEKPEPVPLESRSCVLIRRDLVALPASLISQIGYRCHPKLYSEGDPGEKLELVA    281 - 350
GSGVYITRGQLMNCHLCAGVKHKVLLRRLLATFFDRNTLANSCGTGIRSSTSDPSRKPLDSRVLNAVKLY    351 - 420
CQNFAPSFKESEMNVIAADMCTNARRVRKRWLPKIKSMLPEGVEMYRTVMGSAAASVPLDPEFPPAAAQV    421 - 490
FEQRIYAERRGDAATIVALRTDAVNVDLSAAANPAFDAGEEVDGAGSVIQEVAAPEPLPADGQSPPQPFE    491 - 560
QGGGGPSRPQTPAAAARRPEGTYAGTL                                               561 - 587
//

Text Mined References (8)

PMID Year Title
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
22926524 2013 RBB, a novel transcription repressor, represses the transcription of HDM2 oncogene.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.