Property Summary

NCBI Gene PubMed Count 7
PubMed Score 77.13
PubTator Score 19.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung cancer 2798 1.78456435928994E-11
group 4 medulloblastoma 1875 6.1878158424324E-10
psoriasis 6685 1.03535339388327E-7
acute quadriplegic myopathy 1157 3.96054453937456E-7
tuberculosis 1563 4.99539714500877E-6
pilocytic astrocytoma 3086 1.06346989570268E-5
ovarian cancer 8492 1.51281167121142E-5
medulloblastoma, large-cell 6234 1.64498050581295E-5
dermatomyositis 967 2.01476687660711E-4
osteosarcoma 7933 9.4551637057931E-4
atypical teratoid / rhabdoid tumor 4369 0.0047327311119547
invasive ductal carcinoma 2950 0.00689416432080813
astrocytoma 1493 0.0119376790003203
non primary Sjogren syndrome sicca 840 0.0144312331140083
gastric carcinoma 832 0.0278602638629672
primitive neuroectodermal tumor 3031 0.0358214863240964

Expression

  Differential Expression (16)

Disease log2 FC p
psoriasis -1.300 0.000
osteosarcoma -1.904 0.001
group 4 medulloblastoma -4.200 0.000
astrocytoma 2.000 0.012
atypical teratoid / rhabdoid tumor -1.100 0.005
medulloblastoma, large-cell -4.900 0.000
primitive neuroectodermal tumor -1.300 0.036
acute quadriplegic myopathy 1.233 0.000
tuberculosis 2.300 0.000
non-small cell lung cancer -1.093 0.000
pilocytic astrocytoma 1.400 0.000
non primary Sjogren syndrome sicca 1.400 0.014
gastric carcinoma 1.100 0.028
invasive ductal carcinoma -1.700 0.007
ovarian cancer 2.300 0.000
dermatomyositis 1.700 0.000

Synonym

Accession Q96BF6 NAC-2
Symbols RBB
BEND9
NAC-2
BTBD14
BTBD31
BTBD14A

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Platypus OMA Inparanoid
Chicken OMA Inparanoid

Pathway (1)

Gene RIF (3)

PMID Text
22926524 RBB is a novel transcriptional repressor and an important regulator of p53 pathway.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18976975 Knockdown of NACC family member 2, BEN and BTB (POZ) domain containing (NACC2) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells

AA Sequence

MSQMLHIEIPNFGNTVLGCLNEQRLLGLYCDVSIVVKGQAFKAHRAVLAASSLYFRDLFSGNSKSAFELP      1 - 70
GSVPPACFQQILSFCYTGRLTMTASEQLVVMYTAGFLQIQHIVERGTDLMFKVSSPHCDSQTAVIEDAGS     71 - 140
EPQSPCNQLQPAAAAAAPYVVSPSVPIPLLTRVKHEAMELPPAGPGLAPKRPLETGPRDGVAVAAGAAVA    141 - 210
AGTAPLKLPRVSYYGVPSLATLIPGIQQMPYPQGERTSPGASSLPTTDSPTSYHNEEDEEDDEAYDTMVE    211 - 280
EQYGQMYIKASGSYAVQEKPEPVPLESRSCVLIRRDLVALPASLISQIGYRCHPKLYSEGDPGEKLELVA    281 - 350
GSGVYITRGQLMNCHLCAGVKHKVLLRRLLATFFDRNTLANSCGTGIRSSTSDPSRKPLDSRVLNAVKLY    351 - 420
CQNFAPSFKESEMNVIAADMCTNARRVRKRWLPKIKSMLPEGVEMYRTVMGSAAASVPLDPEFPPAAAQV    421 - 490
FEQRIYAERRGDAATIVALRTDAVNVDLSAAANPAFDAGEEVDGAGSVIQEVAAPEPLPADGQSPPQPFE    491 - 560
QGGGGPSRPQTPAAAARRPEGTYAGTL                                               561 - 587
//

Text Mined References (8)

PMID Year Title
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
22926524 2013 RBB, a novel transcription repressor, represses the transcription of HDM2 oncogene.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.