Property Summary

NCBI Gene PubMed Count 29
PubMed Score 32.02
PubTator Score 18.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.400 2.4e-05
glioblastoma 1.300 3.5e-06
group 3 medulloblastoma 2.000 1.5e-05
lung cancer 1.600 1.1e-02
medulloblastoma, large-cell 1.900 1.0e-05
osteosarcoma -1.355 2.4e-03
pediatric high grade glioma 1.500 7.3e-05
primitive neuroectodermal tumor 1.700 1.3e-04
psoriasis 1.700 1.3e-140

 GO Function (1)

Gene RIF (19)

AA Sequence

MASSDLEQLCSHVNEKIGNIKKTLSLRNCGQEPTLKTVLNKIGDEIIVINELLNKLELEIQYQEQTNNSL      1 - 70
KELCESLEEDYKDIEHLKENVPSHLPQVTVTQSCVKGSDLDPEEPIKVEEPEPVKKPPKEQRSIKEMPFI     71 - 140
TCDEFNGVPSYMKSRLTYNQINDVIKEINKAVISKYKILHQPKKSMNSVTRNLYHRFIDEETKDTKGRYF    141 - 210
IVEADIKEFTTLKADKKFHVLLNILRHCRRLSEVRGGGLTRYVIT                             211 - 255
//

Text Mined References (32)

PMID Year Title