Property Summary

NCBI Gene PubMed Count 24
PubMed Score 5.51
PubTator Score 5.90

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q96BD6 A2A275 Q59FA1 Q5TIH9 Q9BRY9 Q9H6C5 SSB-1
Symbols SSB1
SSB-1

Gene

PDB

2JK9   3F2O  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (6)

AA Sequence

MGQKVTGGIKTVDMRDPTYRPLKQELQGLDYCKPTRLDLLLDMPPVSYDVQLLHSWNNNDRSLNVFVKED      1 - 70
DKLIFHRHPVAQSTDAIRGKVGYTRGLHVWQITWAMRQRGTHAVVGVATADAPLHSVGYTTLVGNNHESW     71 - 140
GWDLGRNRLYHDGKNQPSKTYPAFLEPDETFIVPDSFLVALDMDDGTLSFIVDGQYMGVAFRGLKGKKLY    141 - 210
PVVSAVWGHCEIRMRYLNGLDPEPLPLMDLCRRSVRLALGRERLGEIHTLPLPASLKAYLLYQ           211 - 273
//

Text Mined References (26)

PMID Year Title