Property Summary

NCBI Gene PubMed Count 23
Grant Count 5
R01 Count 5
Funding $265,196.16
PubMed Score 5.45
PubTator Score 5.90

Knowledge Summary

Patent

No data available

Expression

Gene RIF (5)

PMID Text
26032413 SPSB1 negatively regulates the TGF-beta signaling pathway through its interaction with both endogenous and overexpressed TbetaRII (and not TbetaRI) via its Spry domain.
24786206 Findings define a novel pathway that contributes to breast cancer recurrence and provide evidence implicating SPSB proteins in cancer.
23333304 HIV-1 Vif downregulates the expression of splA/ryanodine receptor domain and SOCS box containing 1 (SPSB1) in Vif-expression T cells
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19683501 SSB1/2 is part of an ssDNA-binding heterotrimeric complex, SOSS which is involved in the maintenance of genome stability.

AA Sequence

MGQKVTGGIKTVDMRDPTYRPLKQELQGLDYCKPTRLDLLLDMPPVSYDVQLLHSWNNNDRSLNVFVKED      1 - 70
DKLIFHRHPVAQSTDAIRGKVGYTRGLHVWQITWAMRQRGTHAVVGVATADAPLHSVGYTTLVGNNHESW     71 - 140
GWDLGRNRLYHDGKNQPSKTYPAFLEPDETFIVPDSFLVALDMDDGTLSFIVDGQYMGVAFRGLKGKKLY    141 - 210
PVVSAVWGHCEIRMRYLNGLDPEPLPLMDLCRRSVRLALGRERLGEIHTLPLPASLKAYLLYQ           211 - 273
//

Text Mined References (25)

PMID Year Title
26032413 2015 SPSB1, a Novel Negative Regulator of the Transforming Growth Factor-? Signaling Pathway Targeting the Type II Receptor.
25203322 2014 PKD1 phosphorylation-dependent degradation of SNAIL by SCF-FBXO11 regulates epithelial-mesenchymal transition and metastasis.
24786206 2014 SPSB1 promotes breast cancer recurrence by potentiating c-MET signaling.
23455924 2013 A Y2H-seq approach defines the human protein methyltransferase interactome.
23064961 2013 GWAS of dental caries patterns in the permanent dentition.
22658931 2012 A genome-wide association study of host genetic determinants of the antibody response to Anthrax Vaccine Adsorbed.
22491018 2013 Genome-wide association analysis implicates the involvement of eight loci with response to tocilizumab for the treatment of rheumatoid arthritis.
20561531 2010 Structural basis for Par-4 recognition by the SPRY domain- and SOCS box-containing proteins SPSB1, SPSB2, and SPSB4.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19683501 2009 SOSS complexes participate in the maintenance of genomic stability.
More...