Property Summary

NCBI Gene PubMed Count 18
PubMed Score 7.14
PubTator Score 3.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
atypical teratoid/rhabdoid tumor 1.100 1.9e-05
medulloblastoma 1.100 2.4e-06
osteosarcoma -1.382 1.0e-05
ovarian cancer -1.700 2.0e-11

Gene RIF (5)

AA Sequence

MELQTLQEALKVEIQVHQKLVAQMKQDPQNADLKKQLHELQAKITALSEKQKRVVEQLRKNLIVKQEQPD      1 - 70
KFQIQPLPQSENKLQTAQQQPLQQLQQQQQYHHHHAQQSAAASPNLTASQKTVTTASMITTKTLPLVLKA     71 - 140
ATATMPASVVGQRPTIAMVTAINSQKAVLSTDVQNTPVNLQTSSKVTGPGAEAVQIVAKNTVTLVQATPP    141 - 210
QPIKVPQFIPPPRLTPRPNFLPQVRPKPVAQNNIPIAPAPPPMLAAPQLIQRPVMLTKFTPTTLPTSQNS    211 - 280
IHPVRVVNGQTATIAKTFPMAQLTSIVIATPGTRLAGPQTVQLSKPSLEKQTVKSHTETDEKQTESRTIT    281 - 350
PPAAPKPKREENPQKLAFMVSLGLVTHDHLEEIQSKRQERKRRTTANPVYSGAVFEPERKKSAVTYLNST    351 - 420
MHPGTRKRGRPPKYNAVLGFGALTPTSPQSSHPDSPENEKTETTFTFPAPVQPVSLPSPTSTDGDIHEDF    421 - 490
CSVCRKSGQLLMCDTCSRVYHLDCLDPPLKTIPKGMWICPRCQDQMLKKEEAIPWPGTLAIVHSYIAYKA    491 - 560
AKEEEKQKLLKWSSDLKQEREQLEQKVKQLSNSISKCMEMKNTILARQKEMHSSLEKVKQLIRLIHGIDL    561 - 630
SKPVDSEATVGAISNGPDCTPPANAATSTPAPSPSSQSCTANCNQGEETK                        631 - 680
//

Text Mined References (27)

PMID Year Title