Property Summary

NCBI Gene PubMed Count 16
PubMed Score 42.78
PubTator Score 14.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
active Crohn's disease 1.274 3.8e-02
active ulcerative colitis 1.631 4.9e-03
Astrocytoma, Pilocytic -1.400 1.5e-04
atypical teratoid / rhabdoid tumor -2.200 4.9e-10
Breast cancer -2.300 3.0e-02
colon cancer 2.200 5.9e-04
ependymoma -1.200 4.5e-04
glioblastoma -1.400 1.5e-03
group 3 medulloblastoma -2.300 4.5e-04
intraductal papillary-mucinous carcinoma... 2.200 8.8e-04
intraductal papillary-mucinous neoplasm ... 2.800 2.4e-04
lung cancer -1.900 1.4e-03
lung carcinoma -1.200 2.9e-07
malignant mesothelioma 6.300 8.3e-10
medulloblastoma, large-cell -1.400 4.4e-02
non-small cell lung cancer -1.283 1.5e-06
pancreatic cancer 1.900 2.8e-05
primitive neuroectodermal tumor -1.900 2.6e-03
psoriasis 1.600 5.8e-04
spina bifida -1.754 3.0e-02
subependymal giant cell astrocytoma -1.217 3.5e-02
tuberculosis -3.700 1.1e-08

Gene RIF (7)

AA Sequence

MPLHQLGDKPLTFPSPNSAMENGLDHTPPSRRASPGTPLSPGSLRSAAHSPLDTSKQPLCQLWAEKHGAR      1 - 70
GTHEVRYVSAGQSVACGWWAFAPPCLQVLNTPKGILFFLCAAAFLQGMTVNGFINTVITSLERRYDLHSY     71 - 140
QSGLIASSYDIAACLCLTFVSYFGGSGHKPRWLGWGVLLMGTGSLVFALPHFTAGRYEVELDAGVRTCPA    141 - 210
NPGAVCADSTSGLSRYQLVFMLGQFLHGVGATPLYTLGVTYLDENVKSSCSPVYIAIFYTAAILGPAAGY    211 - 280
LIGGALLNIYTEMGRRTELTTESPLWVGAWWVGFLGSGAAAFFTAVPILGYPRQLPGSQRYAVMRAAEMH    281 - 350
QLKDSSRGEASNPDFGKTIRDLPLSIWLLLKNPTFILLCLAGATEATLITGMSTFSPKFLESQFSLSASE    351 - 420
AATLFGYLVVPAGGGGTFLGGFFVNKLRLRGSAVIKFCLFCTVVSLLGILVFSLHCPSVPMAGVTASYGG    421 - 490
SLLPEGHLNLTAPCNAACSCQPEHYSPVCGSDGLMYFSLCHAGCPAATETNVDGQKVYRDCSCIPQNLSS    491 - 560
GFGHATAGKCTSTCQRKPLLLVFIFVVIFFTFLSSIPALTATLRCVRDPQRSFALGIQWIVVRILGGIPG    561 - 630
PIAFGWVIDKACLLWQDQCGQQGSCLVYQNSAMSRYILIMGLLYKVLGVLFFAIACFLYKPLSESSDGLE    631 - 700
TCLPSQSSAPDSATDSQLQSSV                                                    701 - 722
//

Text Mined References (20)

PMID Year Title