Property Summary

NCBI Gene PubMed Count 15
Grant Count 18
R01 Count 17
Funding $1,419,791.08
PubMed Score 39.56
PubTator Score 14.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Gene RIF (5)

PMID Text
26349991 our results revealed altered OATP3A1 and OATP4A1 mRNA levels and novel mechanisms that might be involved in their regulation in colorectal cancer
25301452 High OATP4A1 expression is associated with small cell lung cancer.
21486766 Compared with the adult cerebral cortex, mRNAs encoding OATP1A2, OATP1C1, OATP3A1 variant 2, OATP4A1, LAT2 and CD98 were reduced in fetal cortex at different gestational ages, whilst mRNAs encoding MCT8, MCT10, OATP3A1 variant 1 and LAT1 were similar.
19343046 Observational study of gene-disease association. (HuGE Navigator)
15994332 oligomerization of Oatp1a1 with PDZK1 is critical for its proper subcellular localization and function

AA Sequence

MPLHQLGDKPLTFPSPNSAMENGLDHTPPSRRASPGTPLSPGSLRSAAHSPLDTSKQPLCQLWAEKHGAR      1 - 70
GTHEVRYVSAGQSVACGWWAFAPPCLQVLNTPKGILFFLCAAAFLQGMTVNGFINTVITSLERRYDLHSY     71 - 140
QSGLIASSYDIAACLCLTFVSYFGGSGHKPRWLGWGVLLMGTGSLVFALPHFTAGRYEVELDAGVRTCPA    141 - 210
NPGAVCADSTSGLSRYQLVFMLGQFLHGVGATPLYTLGVTYLDENVKSSCSPVYIAIFYTAAILGPAAGY    211 - 280
LIGGALLNIYTEMGRRTELTTESPLWVGAWWVGFLGSGAAAFFTAVPILGYPRQLPGSQRYAVMRAAEMH    281 - 350
QLKDSSRGEASNPDFGKTIRDLPLSIWLLLKNPTFILLCLAGATEATLITGMSTFSPKFLESQFSLSASE    351 - 420
AATLFGYLVVPAGGGGTFLGGFFVNKLRLRGSAVIKFCLFCTVVSLLGILVFSLHCPSVPMAGVTASYGG    421 - 490
SLLPEGHLNLTAPCNAACSCQPEHYSPVCGSDGLMYFSLCHAGCPAATETNVDGQKVYRDCSCIPQNLSS    491 - 560
GFGHATAGKCTSTCQRKPLLLVFIFVVIFFTFLSSIPALTATLRCVRDPQRSFALGIQWIVVRILGGIPG    561 - 630
PIAFGWVIDKACLLWQDQCGQQGSCLVYQNSAMSRYILIMGLLYKVLGVLFFAIACFLYKPLSESSDGLE    631 - 700
TCLPSQSSAPDSATDSQLQSSV                                                    701 - 722
//

Text Mined References (19)

PMID Year Title
26349991 2015 Effect of DNA methylation profile on OATP3A1 and OATP4A1 transcript levels in colorectal cancer.
25301452 2015 Specific expression of OATPs in primary small cell lung cancer (SCLC) cells as novel biomarkers for diagnosis and therapy.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21486766 2011 The expression of thyroid hormone transporters in the human fetal cerebral cortex during early development and in N-Tera-2 neurodifferentiation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16341674 2005 Transcriptome analysis of human gastric cancer.
15994332 2005 Interaction with PDZK1 is required for expression of organic anion transporting protein 1A1 on the hepatocyte surface.
More...