Property Summary

NCBI Gene PubMed Count 36
PubMed Score 30.66
PubTator Score 414.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
active ulcerative colitis 1.568 8.6e-04
Astrocytoma, Pilocytic 1.300 5.8e-05
Breast cancer 1.300 1.2e-06
esophageal adenocarcinoma 2.000 1.8e-02
group 3 medulloblastoma -1.100 2.0e-02
lung cancer -1.800 5.4e-05
osteosarcoma 1.788 4.0e-02
pancreatic ductal adenocarcinoma liver m... 1.600 1.5e-02
pituitary cancer -1.200 4.7e-04
Polycystic ovary syndrome -1.220 1.0e-02
psoriasis -2.000 2.1e-04

Protein-protein Interaction (6)

Gene RIF (25)

AA Sequence

MDAVLEPFPADRLFPGSSFLDLGDLNESDFLNNAHFPEHLDHFTENMEDFSNDLFSSFFDDPVLDEKSPL      1 - 70
LDMELDSPTPGIQAEHSYSLSGDSAPQSPLVPIKMEDTTQDAEHGAWALGHKLCSIMVKQEQSPELPVDP     71 - 140
LAAPSAMAAAAAMATTPLLGLSPLSRLPIPHQAPGEMTQLPVIKAEPLEVNQFLKVTPEDLVQMPPTPPS    141 - 210
SHGSDSDGSQSPRSLPPSSPVRPMARSSTAISTSPLLTAPHKLQGTSGPLLLTEEEKRTLIAEGYPIPTK    211 - 280
LPLTKAEEKALKRVRRKIKNKISAQESRRKKKEYVECLEKKVETFTSENNELWKKVETLENANRTLLQQL    281 - 350
QKLQTLVTNKISRPYKMAATQTGTCLMVAALCFVLVLGSLVPCLPEFSSGSQTVKEDPLAADGVYTASQM    351 - 420
PSRSLLFYDDGAGLWEDGRSTLLPMEPPDGWEINPGGPAEQRPRDHLQHDHLDSTHETTKYLSEAWPKDG    421 - 490
GNGTSPDFSHSKEWFHDRDLGPNTTIKLS                                             491 - 519
//

Text Mined References (41)

PMID Year Title