Property Summary

NCBI Gene PubMed Count 29
Grant Count 8
R01 Count 6
Funding $694,880.08
PubMed Score 24.34
PubTator Score 414.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
esophageal adenocarcinoma 2.000 0.018
psoriasis -2.000 0.000
osteosarcoma 1.788 0.040
pancreatic ductal adenocarcinoma liver m... 1.600 0.015
lung cancer -1.800 0.000
active ulcerative colitis 1.568 0.001
group 3 medulloblastoma -1.100 0.020
pilocytic astrocytoma 1.300 0.000
Polycystic Ovary Syndrome -1.220 0.010
Breast cancer 1.300 0.000
pituitary cancer -1.200 0.000

Gene RIF (22)

PMID Text
26810754 Our data further strengthens the role for CREB3L1 as a metastasis suppressor in breast cancer and demonstrates that epigenetic silencing is a major regulator of the loss of CREB3L1 expression
26110425 CREB3L1 was expressed in 19% of RCC, which is generally resistant to doxorubicin, but in 70% of diffuse large B-cell lymphoma that is sensitive to doxorubicin.
25625847 CREB3L1 mRNA expression is downregulated in human bladder cancer.CREB3L1 is epigenetically silenced in human bladder cancer facilitating tumor cell spreading and migration in vitro.
25353281 Case Reports: genetically confirmed primary renal sclerosing epithelioid fibrosarcoma with EWSR1-CREB3L1 gene fusion.
25310401 Cleavage of CREB3L1 releases its NH2-terminal domain from membranes, allowing it to enter the nucleus where it binds to Smad4 to activate transcription of genes encoding proteins required for assembly of collagen-containing extracellular matrix.
24896634 Case Report: low-grade fibromyxoid sarcoma of the kidney found to harbor the EWSR1-CREB3L1 gene fusion.
24441665 EWSR1-CREB3L1 gene fusions are predominant over FUS and CREB3L2 rearrangements in pure sclerosing epithelioid fibrosarcoma.
24242870 Temporally regulates the differentiation from neural precursor cells into astrocytes [review]
24126059 CREB3L1 plays an important role in suppressing tumorigenesis and that loss of expression is required for the development of a metastatic phenotype.
23955342 Fbxw7 controls osteogenesis and chondrogenesis by targeting OASIS and BBF2H7, respectively, for degradation.
More...

AA Sequence

MDAVLEPFPADRLFPGSSFLDLGDLNESDFLNNAHFPEHLDHFTENMEDFSNDLFSSFFDDPVLDEKSPL      1 - 70
LDMELDSPTPGIQAEHSYSLSGDSAPQSPLVPIKMEDTTQDAEHGAWALGHKLCSIMVKQEQSPELPVDP     71 - 140
LAAPSAMAAAAAMATTPLLGLSPLSRLPIPHQAPGEMTQLPVIKAEPLEVNQFLKVTPEDLVQMPPTPPS    141 - 210
SHGSDSDGSQSPRSLPPSSPVRPMARSSTAISTSPLLTAPHKLQGTSGPLLLTEEEKRTLIAEGYPIPTK    211 - 280
LPLTKAEEKALKRVRRKIKNKISAQESRRKKKEYVECLEKKVETFTSENNELWKKVETLENANRTLLQQL    281 - 350
QKLQTLVTNKISRPYKMAATQTGTCLMVAALCFVLVLGSLVPCLPEFSSGSQTVKEDPLAADGVYTASQM    351 - 420
PSRSLLFYDDGAGLWEDGRSTLLPMEPPDGWEINPGGPAEQRPRDHLQHDHLDSTHETTKYLSEAWPKDG    421 - 490
GNGTSPDFSHSKEWFHDRDLGPNTTIKLS                                             491 - 519
//

Text Mined References (34)

PMID Year Title
27499293 2016 Inverting the Topology of a Transmembrane Protein by Regulating the Translocation of the First Transmembrane Helix.
26810754 2016 Epigenetic silencing of CREB3L1 by DNA methylation is associated with high-grade metastatic breast cancers with poor prognosis and is prevalent in triple negative breast cancers.
26110425 2015 Identification of CREB3L1 as a Biomarker Predicting Doxorubicin Treatment Outcome.
25625847 2014 OASIS/CREB3L1 is epigenetically silenced in human bladder cancer facilitating tumor cell spreading and migration in vitro.
25416956 2014 A proteome-scale map of the human interactome network.
25353281 2015 Primary renal sclerosing epithelioid fibrosarcoma: report of 2 cases with EWSR1-CREB3L1 gene fusion.
25310401 2014 Sustained induction of collagen synthesis by TGF-? requires regulated intramembrane proteolysis of CREB3L1.
24896634 Primary low-grade fibromyxoid sarcoma of the kidney in a child with the alternative EWSR1-CREB3L1 gene fusion.
24441665 2014 Recurrent EWSR1-CREB3L1 gene fusions in sclerosing epithelioid fibrosarcoma.
24242870 2014 Physiological functions of endoplasmic reticulum stress transducer OASIS in central nervous system.
More...