Property Summary

NCBI Gene PubMed Count 85
PubMed Score 60.60
PubTator Score 68.35

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Colonic Neoplasms 126
Disease Target Count P-value
non-small cell lung cancer 2798 3.17300361161272E-20
posterior fossa group A ependymoma 1511 5.8222560448493E-12
tuberculosis 1563 6.47545027794925E-9
group 4 medulloblastoma 1875 2.99774803093894E-6
medulloblastoma, large-cell 6234 3.36662685741936E-5
atypical teratoid / rhabdoid tumor 4369 6.36783739566573E-5
pancreatic cancer 2300 3.3469111150704E-4
primary pancreatic ductal adenocarcinoma 1271 3.64302790701266E-4
ovarian cancer 8492 4.39683693699163E-4
invasive ductal carcinoma 2950 8.24314713931582E-4
interstitial cystitis 2299 0.00148134276831455
astrocytic glioma 2241 0.00161831787421877
osteosarcoma 7933 0.00208841309087427
breast carcinoma 1614 0.0023374051990454
Atopic dermatitis 944 0.0023448691375661
glioblastoma 5572 0.00247676968888705
oligodendroglioma 2849 0.00391671622704834
adult high grade glioma 2148 0.0100043357003828
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0104943169053517
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0122334099018872
primitive neuroectodermal tumor 3031 0.0125631428909043
gastric carcinoma 832 0.024172557177781
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0283807372910741
fibroadenoma 557 0.0364416452515153
primary Sjogren syndrome 789 0.0424080298673321
acute myeloid leukemia 785 0.0473837369143107

Expression

Synonym

Accession Q96B97 B7Z1D5 Q5JPT4 Q5JPT5 Q8IWX6 Q8IX98 Q96RN4 Q9NYR0
Symbols HSB1
CIN85
GIG10
HSB-1
MIG18
CD2BP3

Gene

PANTHER Protein Class (1)

PDB

2K6D   2BZ8   2K9G   2N64   2O2O   2YDL   5ABS  

  Ortholog (12)

Gene RIF (43)

PMID Text
26169354 CIN85 promotes recycling of TGF-beta receptors and thereby positively regulates TGF-beta signaling.
25816594 Multiple molecular forms of adaptor protein Ruk/CIN85 specifically associate with different subcellular compartments in human breast adenocarcinoma cell line.
25496667 Genome-wide shRNA screening identifies SH3KBP1, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
25472714 we demonstrate that SEPT9 negatively regulates EGFR degradation by preventing the association of the ubiquitin ligase Cbl with CIN85, resulting in reduced EGFR ubiquitylation
25449262 Results support the model that Cbl-CIN85-endophilin complex is not required for efficient internalization of EGFR, a prototype RTK.
24167568 LOX-PP interacts with CIN85 via a novel SH3-binding motif and this association reduces CIN85-promoted invasion by breast cancer cells.
23279575 an FRS2beta-CIN85/CD2AP-Cbl axis for downregulation of ErbB2 may regulate ErbB2 protein levels in physiological and pathological settings
22833562 Data show that EGFR activation leads to a pronounced src-mediated tyrosine phosphorylation of CIN85 that subsequently influences EGFR ubiquitination.
22791810 this study indicates that high levels of Ruk(l)/CIN85 contribute to the conversion of breast adenocarcinoma cells into a more malignant phenotype via modulation of the Src/Akt pathway.
22262777 Data show that CIN85 (c-Cbl interacting protein of 85 kDa) is constitutively associated with c-Cbl, Cbl-b, and B-cell linker in B cells.
More...

AA Sequence

MVEAIVEFDYQAQHDDELTISVGEIITNIRKEDGGWWEGQINGRRGLFPDNFVREIKKEMKKDPLTNKAP      1 - 70
EKPLHEVPSGNSLLSSETILRTNKRGERRRRRCQVAFSYLPQNDDELELKVGDIIEVVGEVEEGWWEGVL     71 - 140
NGKTGMFPSNFIKELSGESDELGISQDEQLSKSSLRETTGSESDGGDSSSTKSEGANGTVATAAIQPKKV    141 - 210
KGVGFGDIFKDKPIKLRPRSIEVENDFLPVEKTIGKKLPATTATPDSSKTEMDSRTKSKDYCKVIFPYEA    211 - 280
QNDDELTIKEGDIVTLINKDCIDVGWWEGELNGRRGVFPDNFVKLLPPDFEKEGNRPKKPPPPSAPVIKQ    281 - 350
GAGTTERKHEIKKIPPERPEMLPNRTEEKERPEREPKLDLQKPSVPAIPPKKPRPPKTNSLSRPGALPPR    351 - 420
RPERPVGPLTHTRGDSPKIDLAGSSLSGILDKDLSDRSNDIDLEGFDSVVSSTEKLSHPTTSRPKATGRR    421 - 490
PPSQSLTSSSLSSPDIFDSPSPEEDKEEHISLAHRGVDASKKTSKTVTISQVSDNKASLPPKPGTMAAGG    491 - 560
GGPAPLSSAAPSPLSSSLGTAGHRANSPSLFGTEGKPKMEPAASSQAAVEELRTQVRELRSIIETMKDQQ    561 - 630
KREIKQLLSELDEEKKIRLRLQMEVNDIKKALQSK                                       631 - 665
//

Text Mined References (95)

PMID Year Title
26169354 2015 CIN85 modulates TGF? signaling by promoting the presentation of TGF? receptors on the cell surface.
25816594 Multiple molecular forms of adaptor protein Ruk/CIN85 specifically associate with different subcellular compartments in human breast adenocarcinoma MCF-7 cells.
25472714 2015 SEPT9 negatively regulates ubiquitin-dependent downregulation of EGFR.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25449262 2014 Cbl-family ubiquitin ligases and their recruitment of CIN85 are largely dispensable for epidermal growth factor receptor endocytosis.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24167568 2013 Inhibition of CIN85-mediated invasion by a novel SH3 domain binding motif in the lysyl oxidase propeptide.
23663663 2013 Multimeric and differential binding of CIN85/CD2AP with two atypical proline-rich sequences from CD2 and Cbl-b*.
23279575 2013 Adaptor protein complex of FRS2? and CIN85/CD2AP provides a novel mechanism for ErbB2/HER2 protein downregulation.
More...