Property Summary

NCBI Gene PubMed Count 89
PubMed Score 71.14
PubTator Score 68.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
acute myeloid leukemia 1.600 4.7e-02
adult high grade glioma -1.200 1.0e-02
astrocytic glioma -1.300 1.6e-03
Atopic dermatitis -1.200 2.3e-03
atypical teratoid / rhabdoid tumor -1.400 1.1e-02
breast carcinoma -1.100 2.3e-03
ependymoma -1.400 1.4e-02
fibroadenoma -1.300 3.6e-02
gastric carcinoma 1.200 2.4e-02
glioblastoma -1.400 2.5e-03
group 3 medulloblastoma -1.300 1.6e-02
interstitial cystitis 1.100 1.5e-03
intraductal papillary-mucinous adenoma (... 1.800 1.2e-02
intraductal papillary-mucinous carcinoma... 1.900 2.8e-02
intraductal papillary-mucinous neoplasm ... 2.900 1.0e-02
invasive ductal carcinoma -1.600 8.2e-04
medulloblastoma, large-cell -2.700 3.4e-05
non-small cell lung cancer -1.184 3.2e-20
oligodendroglioma -1.300 3.9e-03
osteosarcoma -1.066 2.5e-02
ovarian cancer -1.200 1.5e-04
pancreatic cancer 1.100 9.7e-04
primary pancreatic ductal adenocarcinoma 1.626 3.6e-04
primary Sjogren syndrome 1.200 4.2e-02
primitive neuroectodermal tumor -1.400 1.3e-02
tuberculosis 1.100 6.5e-09

 GO Function (1)

Gene RIF (46)

AA Sequence

MVEAIVEFDYQAQHDDELTISVGEIITNIRKEDGGWWEGQINGRRGLFPDNFVREIKKEMKKDPLTNKAP      1 - 70
EKPLHEVPSGNSLLSSETILRTNKRGERRRRRCQVAFSYLPQNDDELELKVGDIIEVVGEVEEGWWEGVL     71 - 140
NGKTGMFPSNFIKELSGESDELGISQDEQLSKSSLRETTGSESDGGDSSSTKSEGANGTVATAAIQPKKV    141 - 210
KGVGFGDIFKDKPIKLRPRSIEVENDFLPVEKTIGKKLPATTATPDSSKTEMDSRTKSKDYCKVIFPYEA    211 - 280
QNDDELTIKEGDIVTLINKDCIDVGWWEGELNGRRGVFPDNFVKLLPPDFEKEGNRPKKPPPPSAPVIKQ    281 - 350
GAGTTERKHEIKKIPPERPEMLPNRTEEKERPEREPKLDLQKPSVPAIPPKKPRPPKTNSLSRPGALPPR    351 - 420
RPERPVGPLTHTRGDSPKIDLAGSSLSGILDKDLSDRSNDIDLEGFDSVVSSTEKLSHPTTSRPKATGRR    421 - 490
PPSQSLTSSSLSSPDIFDSPSPEEDKEEHISLAHRGVDASKKTSKTVTISQVSDNKASLPPKPGTMAAGG    491 - 560
GGPAPLSSAAPSPLSSSLGTAGHRANSPSLFGTEGKPKMEPAASSQAAVEELRTQVRELRSIIETMKDQQ    561 - 630
KREIKQLLSELDEEKKIRLRLQMEVNDIKKALQSK                                       631 - 665
//

Text Mined References (99)

PMID Year Title