Property Summary

NCBI Gene PubMed Count 12
Grant Count 4
R01 Count 4
Funding $479,366.5
PubMed Score 1.21
PubTator Score 0.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
interstitial lung disease 1.100 0.013
malignant mesothelioma -2.800 0.000
cutaneous lupus erythematosus -1.200 0.003
osteosarcoma 1.902 0.000
acute quadriplegic myopathy -1.418 0.000
lung cancer -1.600 0.002
interstitial cystitis -1.600 0.000
psoriasis -1.200 0.000
spina bifida -1.291 0.037

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MAKEEPQSISRDLQELQKKLSLLIDSFQNNSKVVAFMKSPVGQYLDSHPFLAFTLLVFIVMSAVPVGFFL      1 - 70
LIVVLTTLAALLGVIILEGLVISVGGFSLLCILCGLGFVSLAMSGMMIASYVVVSSLISCWFSPRPLTQQ     71 - 140
NTSCDFLPAMKSAEFEGLYQE                                                     141 - 161
//

Text Mined References (17)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21516116 2011 Next-generation sequencing to generate interactome datasets.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17562024 2007 Large-scale identification of human genes implicated in epidermal barrier function.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15589683 2004 Identification of promethin and PGLP as two novel up-regulated genes in PPARgamma1-induced adipogenic mouse liver.
More...