Property Summary

NCBI Gene PubMed Count 15
PubMed Score 1.21
PubTator Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (9)

Disease log2 FC p
acute quadriplegic myopathy -1.418 1.4e-04
cutaneous lupus erythematosus -1.200 2.6e-03
interstitial cystitis -1.400 6.7e-04
interstitial lung disease 1.100 1.3e-02
lung cancer -1.600 2.1e-03
malignant mesothelioma -2.800 3.0e-07
osteosarcoma 1.902 6.1e-06
psoriasis -1.200 1.8e-10
spina bifida -1.291 3.7e-02

Gene RIF (1)

AA Sequence

MAKEEPQSISRDLQELQKKLSLLIDSFQNNSKVVAFMKSPVGQYLDSHPFLAFTLLVFIVMSAVPVGFFL      1 - 70
LIVVLTTLAALLGVIILEGLVISVGGFSLLCILCGLGFVSLAMSGMMIASYVVVSSLISCWFSPRPLTQQ     71 - 140
NTSCDFLPAMKSAEFEGLYQE                                                     141 - 161
//

Text Mined References (20)

PMID Year Title