Property Summary

NCBI Gene PubMed Count 38
Grant Count 35
R01 Count 22
Funding $3,202,373
PubMed Score 254.27
PubTator Score 48.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Gene RIF (14)

PMID Text
26721439 Thus, we conclude that RGMa inhibits angiogenesis in vitro and in vivo suggesting that its manipulation would be an efficient therapeutic strategy for pro-angiogenic conditions.
22396795 identification of neogenin-binding site on the repulsive guidance molecule A
22367090 RGMa expression and promoter methylation status are closely related to colorectal cancer genesis and progression.
22076499 The expression of RGMA, RGMB and RGMC was evident in most examined prostate cancer cell lines, and also in the prostate cancer tissues
21617229 Reduced expression of RGMA in breast cancer was associated with breast cancer.
21467223 RGM-A is a unique endogenous inhibitor of leukocyte chemotaxis that limits inflammatory leukocyte traffic
21183991 The full-length signal peptides of RGMa is functional and furthermore that the C-domains are sufficient and essential for ER targeting, whereas the N-domains are dispensable. Thus, the N-domains are available for additional functions.
20072140 Observational study of gene-disease association. (HuGE Navigator)
19303019 Frequent inactivation of axon guidance molecule RGMA in human colon cancer through genetic and epigenetic mechanisms.
19273616 this study, we show that Unc5B, a member of the netrin receptor family, interacts with neogenin as a coreceptor for RGMa.
More...

AA Sequence

MQPPRERLVVTGRAGWMGMGRGAGRSALGFWPTLAFLLCSFPAATSPCKILKCNSEFWSATSGSHAPASD      1 - 70
DTPEFCAALRSYALCTRRTARTCRGDLAYHSAVHGIEDLMSQHNCSKDGPTSQPRLRTLPPAGDSQERSD     71 - 140
SPEICHYEKSFHKHSATPNYTHCGLFGDPHLRTFTDRFQTCKVQGAWPLIDNNYLNVQVTNTPVLPGSAA    141 - 210
TATSKLTIIFKNFQECVDQKVYQAEMDELPAAFVDGSKNGGDKHGANSLKITEKVSGQHVEIQAKYIGTT    211 - 280
IVVRQVGRYLTFAVRMPEEVVNAVEDWDSQGLYLCLRGCPLNQQIDFQAFHTNAEGTGARRLAAASPAPT    281 - 350
APETFPYETAVAKCKEKLPVEDLYYQACVFDLLTTGDVNFTLAAYYALEDVKMLHSNKDKLHLYDRTRDL    351 - 420
PGRAAAGLPLAPRPLLGALVPLLALLPVFC                                            421 - 450
//

Text Mined References (39)

PMID Year Title
26721439 2016 Repulsive guidance molecule A suppresses angiogenesis.
25133637 2014 Genome-wide association studies and heritability estimates of body mass index related phenotypes in Bangladeshi adults.
24024966 2013 Genome-wide association study of chronic periodontitis in a general German population.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23028342 2012 New susceptibility loci associated with kidney disease in type 1 diabetes.
22728873 2012 The hemochromatosis proteins HFE, TfR2, and HJV form a membrane-associated protein complex for hepcidin regulation.
22566498 2012 Genomic association analysis identifies multiple loci influencing antihypertensive response to an angiotensin II receptor blocker.
22396795 2012 Identification of the neogenin-binding site on the repulsive guidance molecule A.
22367090 2012 Decreased expression of repulsive guidance molecule member A by DNA methylation in colorectal cancer is related to tumor progression.
22076499 2012 Repulsive guidance molecules, novel bone morphogenetic protein co-receptors, are key regulators of the growth and aggressiveness of prostate cancer cells.
More...