Property Summary

NCBI Gene PubMed Count 39
PubMed Score 274.77
PubTator Score 48.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma 1.400 6.9e-04
astrocytic glioma 2.000 6.5e-04
breast carcinoma -1.800 9.9e-06
ductal carcinoma in situ -1.600 2.7e-04
glioblastoma 1.600 2.9e-04
intraductal papillary-mucinous adenoma (... -1.300 3.9e-04
intraductal papillary-mucinous carcinoma... -1.300 4.5e-04
invasive ductal carcinoma -1.942 3.6e-04
non-inflammatory breast cancer -2.100 3.3e-03
non-small cell lung cancer 1.495 1.4e-07
oligodendroglioma 2.100 7.0e-04
psoriasis -1.200 1.5e-09

Gene RIF (15)

AA Sequence

MQPPRERLVVTGRAGWMGMGRGAGRSALGFWPTLAFLLCSFPAATSPCKILKCNSEFWSATSGSHAPASD      1 - 70
DTPEFCAALRSYALCTRRTARTCRGDLAYHSAVHGIEDLMSQHNCSKDGPTSQPRLRTLPPAGDSQERSD     71 - 140
SPEICHYEKSFHKHSATPNYTHCGLFGDPHLRTFTDRFQTCKVQGAWPLIDNNYLNVQVTNTPVLPGSAA    141 - 210
TATSKLTIIFKNFQECVDQKVYQAEMDELPAAFVDGSKNGGDKHGANSLKITEKVSGQHVEIQAKYIGTT    211 - 280
IVVRQVGRYLTFAVRMPEEVVNAVEDWDSQGLYLCLRGCPLNQQIDFQAFHTNAEGTGARRLAAASPAPT    281 - 350
APETFPYETAVAKCKEKLPVEDLYYQACVFDLLTTGDVNFTLAAYYALEDVKMLHSNKDKLHLYDRTRDL    351 - 420
PGRAAAGLPLAPRPLLGALVPLLALLPVFC                                            421 - 450
//

Text Mined References (40)

PMID Year Title