Property Summary

NCBI Gene PubMed Count 25
PubMed Score 13.29
PubTator Score 8.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
active Crohn's disease 1.888 1.9e-03
acute quadriplegic myopathy 1.523 6.4e-06
adult high grade glioma 1.200 3.3e-02
Breast cancer -2.900 4.9e-30
chronic lymphosyte leukemia 1.400 2.3e-04
glioblastoma 1.200 3.5e-04
group 4 medulloblastoma 1.600 1.1e-03
interstitial lung disease -1.300 1.4e-02
juvenile dermatomyositis 1.363 1.8e-09
osteosarcoma 1.311 8.0e-03
ovarian cancer -1.300 1.2e-02
pancreatic cancer -1.200 1.4e-04
pancreatic carcinoma -1.200 1.4e-04
posterior fossa group A ependymoma 1.100 4.3e-04
primary pancreatic ductal adenocarcinoma 1.232 8.6e-03
primitive neuroectodermal tumor 1.200 3.6e-03
ulcerative colitis 1.300 9.1e-04

Gene RIF (14)

AA Sequence

MVLGKVKSLTISFDCLNDSNVPVYSSGDTVSGRVNLEVTGEIRVKSLKIHARGHAKVRWTESRNAGSNTA      1 - 70
YTQNYTEEVEYFNHKDILIGHERDDDNSEEGFHTIHSGRHEYAFSFELPQTPLATSFEGRHGSVRYWVKA     71 - 140
ELHRPWLLPVKLKKEFTVFEHIDINTPSLLSPQAGTKEKTLCCWFCTSGPISLSAKIERKGYTPGESIQI    141 - 210
FAEIENCSSRMVVPKAAIYQTQAFYAKGKMKEVKQLVANLRGESLSSGKTETWNGKLLKIPPVSPSILDC    211 - 280
SIIRVEYSLMVYVDIPGAMDLFLNLPLVIGTIPLHPFGSRTSSVSSQCSMNMNWLSLSLPERPEAPPSYA    281 - 350
EVVTEEQRRNNLAPVSACDDFERALQGPLFAYIQEFRFLPPPLYSEIDPNPDQSADDRPSCPSR          351 - 414
//

Text Mined References (27)

PMID Year Title