Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
group 3 medulloblastoma 4104 1.3e-02

Expression

  Differential Expression (1)

Disease log2 FC p
group 3 medulloblastoma 1.100 1.3e-02

Synonym

Accession Q96B54 O95054 Q6X3Y3
Symbols Zfp428
C19orf37

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MTETREPAETGGYASLEEDDEDLSPGPEHSSDSEYTLSEPDSEEEEDEEEEEEETTDDPEYDPGYKVKQR      1 - 70
LGGGRGGPSRRAPRAAQPPAQPCQLCGRSPLGEAPPGTPPCRLCCPATAPQEAPAPEGRALGEEEEEPPR     71 - 140
AGEGRPAGREEEEEEEEEGTYHCTECEDSFDNLGELHGHFMLHARGEV                          141 - 188
//

Text Mined References (6)

PMID Year Title