Property Summary

NCBI Gene PubMed Count 8
PubMed Score 3.80
PubTator Score 4.36

Knowledge Summary

Patent

No data available

Synonym

Accession Q96B49 B2DG15 Q9UH52
Symbols OBTP
TOM6

Gene

Gene RIF (1)

PMID Text
18331822 The human counterparts of Tom5 and Tom6, together with the other components including Tom7, were identified in the preprotein translocase complex.

AA Sequence

MASSTVPVSAAGSANETPEIPDNVGDWLRGVYRFATDRNDFRRNLILNLGLFAAGVWLARNLSDIDLMAP      1 - 70
QPGV                                                                       71 - 74
//

Text Mined References (10)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
21269460 2011 Initial characterization of the human central proteome.
18331822 2008 Identification of Tom5 and Tom6 in the preprotein translocase complex of human mitochondrial outer membrane.
16341674 2005 Transcriptome analysis of human gastric cancer.
16097034 2005 Global phosphoproteome analysis on human HepG2 hepatocytes using reversed-phase diagonal LC.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
7923143 1994 Identification of genes overexpressed in tumors through preferential expression screening in trophoblasts.