Property Summary

NCBI Gene PubMed Count 8
PubMed Score 3.80
PubTator Score 4.36

Knowledge Summary

Patent

No data available

Gene RIF (1)

AA Sequence

MASSTVPVSAAGSANETPEIPDNVGDWLRGVYRFATDRNDFRRNLILNLGLFAAGVWLARNLSDIDLMAP      1 - 70
QPGV                                                                       71 - 74
//

Text Mined References (10)

PMID Year Title