Property Summary

NCBI Gene PubMed Count 13
PubMed Score 1.61
PubTator Score 1.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

AA Sequence

MATGTPESQARFGQSVKGLLTEKVTTCGTDVIALTKQVLKGSRSSELLGQAARNMVLQEDAILHSEDSLR      1 - 70
KMAIITTHLQYQQEAIQKNVEQSSDLQDQLNHLLK                                        71 - 105
//

Text Mined References (14)

PMID Year Title
25898167 2015 BORC, a multisubunit complex that regulates lysosome positioning.
25249183 2015 Genome-wide association study in Chinese identifies novel loci for blood pressure and hypertension.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
23974872 2013 Genome-wide association analysis identifies 13 new risk loci for schizophrenia.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
22383894 2012 Genome-wide association study identifies chromosome 10q24.32 variants associated with arsenic metabolism and toxicity phenotypes in Bangladesh.
19915575 2009 Genome-wide association study reveals genetic risk underlying Parkinson's disease.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...