Property Summary

NCBI Gene PubMed Count 13
PubMed Score 1.61
PubTator Score 1.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Hypertensive disease 193
Schizophrenia 503
Disease Target Count P-value
non-small cell lung cancer 2798 8.44833564623135E-18
lung adenocarcinoma 2714 1.46834258821751E-12
ovarian cancer 8492 7.45050376009536E-9
Pick disease 1893 9.56689520947736E-6
medulloblastoma 1524 9.37596895143205E-4
medulloblastoma, large-cell 6234 0.00117370082990051
diabetes mellitus 1663 0.00178063109047243
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0045962586376813
progressive supranuclear palsy 674 0.00590445370718942
hereditary spastic paraplegia 313 0.0153304451568202
Alzheimer's disease 644 0.0317841809835388
aldosterone-producing adenoma 664 0.0393932331173143

Expression

  Differential Expression (12)

Synonym

Accession Q96B45 B2R488 B3KUW4 C9K0X3
Symbols C10orf32

Gene

  Ortholog (2)

Species Source
Mouse OMA Inparanoid
Zebrafish OMA Inparanoid

AA Sequence

MATGTPESQARFGQSVKGLLTEKVTTCGTDVIALTKQVLKGSRSSELLGQAARNMVLQEDAILHSEDSLR      1 - 70
KMAIITTHLQYQQEAIQKNVEQSSDLQDQLNHLLK                                        71 - 105
//

Text Mined References (14)

PMID Year Title
25898167 2015 BORC, a multisubunit complex that regulates lysosome positioning.
25249183 2015 Genome-wide association study in Chinese identifies novel loci for blood pressure and hypertension.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
23974872 2013 Genome-wide association analysis identifies 13 new risk loci for schizophrenia.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
22383894 2012 Genome-wide association study identifies chromosome 10q24.32 variants associated with arsenic metabolism and toxicity phenotypes in Bangladesh.
19915575 2009 Genome-wide association study reveals genetic risk underlying Parkinson's disease.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...