Property Summary

NCBI Gene PubMed Count 57
PubMed Score 26.02
PubTator Score 29.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Obesity 678 4.978 2.5
Diabetes Mellitus, Type 2 142 0.0 0.0
Disease Target Count P-value
Breast cancer 3578 3.3e-20
osteosarcoma 7950 6.2e-06
sonic hedgehog group medulloblastoma 467 8.7e-06
ovarian cancer 8520 3.8e-04

Expression

  Differential Expression (4)

Disease log2 FC p
Breast cancer -1.100 3.3e-20
osteosarcoma -1.486 6.2e-06
ovarian cancer -1.500 3.8e-04
sonic hedgehog group medulloblastoma 1.100 8.7e-06

Gene RIF (41)

AA Sequence

MPSAFSVSSFPVSIPAVLTQTDWTEPWLMGLATFHALCVLLTCLSSRSYRLQIGHFLCLVILVYCAEYIN      1 - 70
EAAAMNWRLFSKYQYFDSRGMFISIVFSAPLLVNAMIIVVMWVWKTLNVMTDLKNAQERRKEKKRRRKED     71 - 140
//

Text Mined References (60)

PMID Year Title