Property Summary

NCBI Gene PubMed Count 53
PubMed Score 24.50
PubTator Score 29.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.486 0.000
sonic hedgehog group medulloblastoma 1.100 0.000
Breast cancer -1.100 0.000
ovarian cancer -1.500 0.000

Synonym

Accession Q96B42 D6W4X9 Q8N5H2 Q9NTH3
Symbols

Gene

Gene RIF (40)

PMID Text
26365393 Studies indicate association of transmembrane protein 18 (TMEM18) variants within the proximal haplotype block with obesity and body mass.
25640768 Genetic variants associated with BMI and WHR in adults influence growth patterns and general and abdominal fat development from early childhood onwards.
25189249 FTO-rs9939609, TMEM18-rs6548238 and PCSK1-rs6234 polymorphisms are significantly associated with body mass index in a southern Chinese population.
24951660 rs186019316 and rs7596758 in TMEM18 is associated with body mass index.
24763707 TMEM18 mRNA expression levels are related to phenotypes of obesity and glucose metabolism.
23860325 results add to the evidence that BMI related variants in and near FTO and TMEM18 may increase the risk for T2D not only through secondary effects of obesity
23505181 In summary, moderately rare missense variants within the...TMEM18 genes observed in our study did not confer risk of common childhood obesity in African Americans...
23229156 Results imply a regulatory role for TMEM18, BDNF, MTCH2 and NEGR1 in adipocyte differentiation and biology. In addition, we show a variation of MAF expression during adipogenesis, while NPC1, PTER and SH2B1 were not regulated.
22466342 TMEM18rs6548238 associated with risk of diabetes after adjustment for body mass index.
22391885 By age 7, common variations in FTO, TMEM18 and NRXN3 influence the vulnerability to metabolic complications of sleep deprivation.
More...

AA Sequence

MPSAFSVSSFPVSIPAVLTQTDWTEPWLMGLATFHALCVLLTCLSSRSYRLQIGHFLCLVILVYCAEYIN      1 - 70
EAAAMNWRLFSKYQYFDSRGMFISIVFSAPLLVNAMIIVVMWVWKTLNVMTDLKNAQERRKEKKRRRKED     71 - 140
//

Text Mined References (56)

PMID Year Title
27029472 2016 The Drosophila ortholog of TMEM18 regulates insulin and glucagon-like signaling.
26365393 2015 Determination of obesity associated gene variants related to TMEM18 through ultra-deep targeted re-sequencing in a case-control cohort for pediatric obesity.
25640768 2015 Adult adiposity susceptibility loci, early growth and general and abdominal fatness in childhood: the Generation R Study.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
25189249 2014 Polymorphisms in FTO, TMEM18 and PCSK1 are associated with BMI in southern Chinese population.
25130324 2014 A genome-wide search for quantitative trait loci affecting the cortical surface area and thickness of Heschl's gyrus.
24951660 2014 Sequence variation in TMEM18 in association with body mass index: Cohorts for Heart and Aging Research in Genomic Epidemiology (CHARGE) Consortium Targeted Sequencing Study.
24861553 2014 Meta-analysis of genome-wide association studies in East Asian-ancestry populations identifies four new loci for body mass index.
24763707 2014 Adipose tissue depot specific promoter methylation of TMEM18.
24509480 2014 Genome-wide trans-ancestry meta-analysis provides insight into the genetic architecture of type 2 diabetes susceptibility.
More...