Property Summary

NCBI Gene PubMed Count 34
Grant Count 153
R01 Count 68
Funding $24,347,259.38
PubMed Score 165.24
PubTator Score 54.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma 1.417 0.001
atypical teratoid / rhabdoid tumor 1.400 0.000
glioblastoma 1.600 0.000
pediatric high grade glioma 1.200 0.001
Polycystic Ovary Syndrome -1.204 0.029

Synonym

Accession Q96B36 A8MTQ1 B2RE93 J3KPM3 Q96BI4 Q96IK7 Q96NG2 Q9BWR5
Symbols Lobe
PRAS40

Gene

Gene RIF (21)

PMID Text
26003731 This review discusses the role of PRAS40 and possible feedback mechanisms, and alterations in AKT/PRAS40/mTOR signaling that have been implicated in the pathogenesis of tumor progression. [review]
25648575 The frameshift mutation detected in the current study would result in a premature stop of amino-acid synthesis in AKT1S1 protein and hence resembles a typical loss-of-function mutation.
25531317 Supporting this idea, we identified a downstream target of the TGFb-miR-96 signaling pathway to be AKT1S1 mRNA, whose translated protein is a negative regulator of mTOR kinase.
24704832 Findings indicate that dual phosphorylation of PRAS40 by Akt and mTORC1 promotes formation of a nuclear-specific PRAS40- and RPL11-containing complex distinct from mTORC1 that inhibits the RPL11-HDM2-p53 pathway.
24576065 PRAS40 as a regulator of insulin sensitivity in hSkMC
23712034 PRAS40 contains a functional nuclear export signal. Furthermore, enforced nuclear accumulation of PRAS40 impairs insulin action, thereby substantiating the function of this protein in the regulation of insulin sensitivity.
23460019 Data suggest that PRAS40 modulates insulin action in skeletal muscle; knockdown of PRAS40 inhibits insulin action in cultured myotubes and is associated with up-regulation of IRS1 (insulin receptor substrate 1) degradation via proteasome proteolysis.
22873724 WISP1 governs PRAS40 by sequestering PRAS40 intracellularly through post-translational phosphorylation.
22354785 This review summarizes the regulation and potential function(s) of PRAS40 in the complex Akt- and mTOR-signaling network in health and disease--{REVIEW}
22241085 our findings suggest that PRAS40 promotes the development of ESFT
More...

AA Sequence

MASGRPEELWEAVVGAAERFRARTGTELVLLTAAPPPPPRPGPCAYAAHGRGALAEAARRCLHDIALAHR      1 - 70
AATAARPPAPPPAPQPPSPTPSPPRPTLAREDNEEDEDEPTETETSGEQLGISDNGGLFVMDEDATLQDL     71 - 140
PPFCESDPESTDDGSLSEETPAGPPTCSVPPASALPTQQYAKSLPVSVPVWGFKEKRTEARSSDEENGPP    141 - 210
SSPDLDRIAASMRALVLREAEDTQVFGDLPRPRLNTSDFQKLKRKY                            211 - 256
//

Text Mined References (44)

PMID Year Title
26003731 2015 Proline-rich AKT substrate of 40-kDa (PRAS40) in the pathophysiology of cancer.
25648575 2015 Inactivating frameshift mutation of AKT1S1, an mTOR inhibitory gene, in colorectal cancers.
25531317 2015 Transforming growth factor-? promotes prostate bone metastasis through induction of microRNA-96 and activation of the mTOR pathway.
24704832 2015 Nuclear PRAS40 couples the Akt/mTORC1 signaling axis to the RPL11-HDM2-p53 nucleolar stress response pathway.
24576065 2014 Over-expression of PRAS40 enhances insulin sensitivity in skeletal muscle.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23712034 2013 Proline-rich Akt substrate of 40-kDa contains a nuclear export signal.
23460019 2013 Knockdown of PRAS40 inhibits insulin action via proteasome-mediated degradation of IRS1 in primary human skeletal muscle cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...