Property Summary

Ligand Count 1
NCBI Gene PubMed Count 37
PubMed Score 174.16
PubTator Score 54.80

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (5)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.400 1.5e-06
glioblastoma 1.600 3.3e-05
osteosarcoma 1.417 8.3e-04
pediatric high grade glioma 1.200 1.1e-03
Polycystic ovary syndrome -1.204 2.9e-02

Protein-protein Interaction (3)

Gene RIF (24)

AA Sequence

MASGRPEELWEAVVGAAERFRARTGTELVLLTAAPPPPPRPGPCAYAAHGRGALAEAARRCLHDIALAHR      1 - 70
AATAARPPAPPPAPQPPSPTPSPPRPTLAREDNEEDEDEPTETETSGEQLGISDNGGLFVMDEDATLQDL     71 - 140
PPFCESDPESTDDGSLSEETPAGPPTCSVPPASALPTQQYAKSLPVSVPVWGFKEKRTEARSSDEENGPP    141 - 210
SSPDLDRIAASMRALVLREAEDTQVFGDLPRPRLNTSDFQKLKRKY                            211 - 256
//

Text Mined References (48)

PMID Year Title