Property Summary

NCBI Gene PubMed Count 15
PubMed Score 3.81
PubTator Score 4.80

Knowledge Summary

Patent

No data available

Expression

Gene RIF (6)

AA Sequence

MRTPVVMTLGMVLAPCGLLLNLTGTLAPGWRLVKGFLNQPVDVELYQGLWDMCREQSSRERECGQTDQWG      1 - 70
YFEAQPVLVARALMVTSLAATVLGLLLASLGVRCWQDEPNFVLAGLSGVVLFVAGLLGLIPVSWYNHFLG     71 - 140
DRDVLPAPASPVTVQVSYSLVLGYLGSCLLLLGGFSLALSFAPWCDERCRRRRKGPSAGPRRSSVSTIQV    141 - 210
EWPEPDLAPAIKYYSDGQHRPPPAQHRKPKPKPKVGFPMPRPRPKAYTNSVDVLDGEGWESQDAPSCSTH    211 - 280
PCDSSLPCDSDL                                                              281 - 292
//

Text Mined References (15)

PMID Year Title