Property Summary

NCBI Gene PubMed Count 14
PubMed Score 2.83
PubTator Score 4.80

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 3.29087020066763E-95
nasopharyngeal carcinoma 1056 6.70500423954856E-11
non-small cell lung cancer 2798 1.38256540420326E-8
pancreatic cancer 2300 1.13260141751139E-5
ovarian cancer 8492 1.34468759562682E-5
Atopic dermatitis 944 1.38995975230736E-5
osteosarcoma 7933 2.50879178598756E-5
ulcerative colitis 2087 2.56557668810757E-5
cystic fibrosis 1670 2.16245187376104E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 4.77841285498646E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00197260777046999
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00602888065542226
active Crohn's disease 918 0.0124222347356092
primary pancreatic ductal adenocarcinoma 1271 0.0124580330275339
non primary Sjogren syndrome sicca 840 0.0213668533868514
Breast cancer 3099 0.0215510499526643
interstitial cystitis 2299 0.0262430550304357
subependymal giant cell astrocytoma 2287 0.033930510578586
atypical teratoid / rhabdoid tumor 4369 0.0352363157161671

Expression

Synonym

Accession Q96B33 Q08AJ3
Symbols CLDNL
hCG1646163

Gene

PANTHER Protein Class (2)

  Ortholog (6)

Gene RIF (5)

PMID Text
25695204 The present study demonstrated an epigenetic link between the activity of the EZH2 methyltransferase at the CLDN23 locus and the expression of CLDN23 in CRC tissue.
24222123 Down-regulation of CLDN23 is associated with colorectal cancer.
18154640 Observational study of gene-disease association. (HuGE Navigator)
12736707 characterization of CLDN23 gene, a candidate tumor suppressor gene implicated in intestinal-type gastric cancer
12736707 Human CLDN23, showing 79.5% total-amino-acid identity with mouse Cldn23, is a four-transmembrane protein with WWCC motif, defined by W-X(17-22)-W-X(2)-C-X(8-10)-C.

AA Sequence

MRTPVVMTLGMVLAPCGLLLNLTGTLAPGWRLVKGFLNQPVDVELYQGLWDMCREQSSRERECGQTDQWG      1 - 70
YFEAQPVLVARALMVTSLAATVLGLLLASLGVRCWQDEPNFVLAGLSGVVLFVAGLLGLIPVSWYNHFLG     71 - 140
DRDVLPAPASPVTVQVSYSLVLGYLGSCLLLLGGFSLALSFAPWCDERCRRRRKGPSAGPRRSSVSTIQV    141 - 210
EWPEPDLAPAIKYYSDGQHRPPPAQHRKPKPKPKVGFPMPRPRPKAYTNSVDVLDGEGWESQDAPSCSTH    211 - 280
PCDSSLPCDSDL                                                              281 - 292
//

Text Mined References (14)

PMID Year Title
25695204 2015 Regulation of the expression of claudin 23 by the enhancer of zeste 2 polycomb group protein in colorectal cancer.
24483146 2014 Discovery of genetic biomarkers contributing to variation in drug response of cytidine analogues using human lymphoblastoid cell lines.
24222123 2013 Differential expression and prognostic role of selected genes in colorectal cancer patients.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
19706201 2009 The claudins.
19673046 2009 Ion transport and barrier function in a telomerase-immortalized human nondysplastic, Barrett's cell line (BAR-T).
18154640 2007 MRPS18CP2 alleles and DEFA3 absence as putative chromosome 8p23.1 modifiers of hearing loss due to mtDNA mutation A1555G in the 12S rRNA gene.
18036336 2008 Structure and function of claudins.
16273224 2005 Epithelial-mesenchymal transition in gastric cancer (Review).
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...