Property Summary

NCBI Gene PubMed Count 14
PubMed Score 2.83
PubTator Score 4.80

Knowledge Summary

Patent

No data available

Expression

Gene RIF (5)

PMID Text
25695204 The present study demonstrated an epigenetic link between the activity of the EZH2 methyltransferase at the CLDN23 locus and the expression of CLDN23 in CRC tissue.
24222123 Down-regulation of CLDN23 is associated with colorectal cancer.
18154640 Observational study of gene-disease association. (HuGE Navigator)
12736707 characterization of CLDN23 gene, a candidate tumor suppressor gene implicated in intestinal-type gastric cancer
12736707 Human CLDN23, showing 79.5% total-amino-acid identity with mouse Cldn23, is a four-transmembrane protein with WWCC motif, defined by W-X(17-22)-W-X(2)-C-X(8-10)-C.

AA Sequence

MRTPVVMTLGMVLAPCGLLLNLTGTLAPGWRLVKGFLNQPVDVELYQGLWDMCREQSSRERECGQTDQWG      1 - 70
YFEAQPVLVARALMVTSLAATVLGLLLASLGVRCWQDEPNFVLAGLSGVVLFVAGLLGLIPVSWYNHFLG     71 - 140
DRDVLPAPASPVTVQVSYSLVLGYLGSCLLLLGGFSLALSFAPWCDERCRRRRKGPSAGPRRSSVSTIQV    141 - 210
EWPEPDLAPAIKYYSDGQHRPPPAQHRKPKPKPKVGFPMPRPRPKAYTNSVDVLDGEGWESQDAPSCSTH    211 - 280
PCDSSLPCDSDL                                                              281 - 292
//

Text Mined References (14)

PMID Year Title
25695204 2015 Regulation of the expression of claudin 23 by the enhancer of zeste 2 polycomb group protein in colorectal cancer.
24483146 2014 Discovery of genetic biomarkers contributing to variation in drug response of cytidine analogues using human lymphoblastoid cell lines.
24222123 2013 Differential expression and prognostic role of selected genes in colorectal cancer patients.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
19706201 2009 The claudins.
19673046 2009 Ion transport and barrier function in a telomerase-immortalized human nondysplastic, Barrett's cell line (BAR-T).
18154640 2007 MRPS18CP2 alleles and DEFA3 absence as putative chromosome 8p23.1 modifiers of hearing loss due to mtDNA mutation A1555G in the 12S rRNA gene.
18036336 2008 Structure and function of claudins.
16273224 2005 Epithelial-mesenchymal transition in gastric cancer (Review).
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...