Property Summary

NCBI Gene PubMed Count 23
PubMed Score 25.61
PubTator Score 35.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
acute myeloid leukemia -1.600 4.5e-02
colon cancer 1.100 1.2e-02
dermatomyositis 1.100 8.8e-03
glioblastoma multiforme 1.100 2.0e-16
group 3 medulloblastoma 1.500 2.3e-04
malignant mesothelioma 1.400 2.8e-07
oligodendroglioma 1.100 2.1e-12
osteosarcoma -2.365 8.7e-06
ovarian cancer -1.500 1.3e-05
primitive neuroectodermal tumor 1.200 1.9e-04
Waldenstrons macroglobulinemia 1.305 1.4e-03
X-linked cerebral adrenoleukodystrophy 1.200 4.3e-02

 MGI Phenotype (1)

Protein-protein Interaction (11)

Gene RIF (4)

AA Sequence

MAAGFKTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSISTADGSALVKLGNTTVICGVKAEFAAPS      1 - 70
TDAPDKGYVVPNVDLPPLCSSRFRSGPPGEEAQVASQFIADVIENSQIIQKEDLCISPGKLVWVLYCDLI     71 - 140
CLDYDGNILDACTFALLAALKNVQLPEVTINEETALAEVNLKKKSYLNIRTHPVATSFAVFDDTLLIVDP    141 - 210
TGEEEHLATGTLTIVMDEEGKLCCLHKPGGSGLTGAKLQDCMSRAVTRHKEVKKLMDEVIKSMKPK        211 - 276
//

Text Mined References (26)

PMID Year Title