Property Summary

NCBI Gene PubMed Count 19
Grant Count 14
R01 Count 14
Funding $623,573.86
PubMed Score 24.25
PubTator Score 35.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

 GO Function (1)

 MGI Term (1)

Gene RIF (3)

PMID Text
24989451 homozygous missense mutations cause progressive and lethal neurological disease
12419256 Protein-protein interactions between human exosome components support the assembly of RNase PH-type subunits into a six-membered PNPase-like ring.
11929972 A protein subunit of human RNase P, Rpp14, and its interacting partner, OIP2, have 3'-->5' exoribonuclease activity.

AA Sequence

MAAGFKTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSISTADGSALVKLGNTTVICGVKAEFAAPS      1 - 70
TDAPDKGYVVPNVDLPPLCSSRFRSGPPGEEAQVASQFIADVIENSQIIQKEDLCISPGKLVWVLYCDLI     71 - 140
CLDYDGNILDACTFALLAALKNVQLPEVTINEETALAEVNLKKKSYLNIRTHPVATSFAVFDDTLLIVDP    141 - 210
TGEEEHLATGTLTIVMDEEGKLCCLHKPGGSGLTGAKLQDCMSRAVTRHKEVKKLMDEVIKSMKPK        211 - 276
//

Text Mined References (22)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25416956 2014 A proteome-scale map of the human interactome network.
24989451 2014 EXOSC8 mutations alter mRNA metabolism and cause hypomyelination with spinal muscular atrophy and cerebellar hypoplasia.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
21255825 2011 The RNA exosome targets the AID cytidine deaminase to both strands of transcribed duplex DNA substrates.
20531389 2010 Dis3-like 1: a novel exoribonuclease associated with the human exosome.
17545563 2007 Human cell growth requires a functional cytoplasmic exosome, which is involved in various mRNA decay pathways.
17174896 2006 Reconstitution, activities, and structure of the eukaryotic RNA exosome.
16912217 2006 Sequence-specific RNA binding mediated by the RNase PH domain of components of the exosome.
More...