Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.49
PubTator Score 2.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
osteosarcoma 7933 9.59406356582415E-8
ovarian cancer 8492 1.71039947836143E-7
posterior fossa group B ependymoma 1530 4.87302298386077E-7
pituitary cancer 1972 5.18627940548434E-5
cutaneous lupus erythematosus 1056 0.00333305191360184
group 4 medulloblastoma 1875 0.0063497090751784
esophageal adenocarcinoma 737 0.0192550983916313
spina bifida 1064 0.0401937492659501

Expression

  Differential Expression (8)

Disease log2 FC p
posterior fossa group B ependymoma 1.400 0.000
esophageal adenocarcinoma -1.400 0.019
cutaneous lupus erythematosus 1.300 0.003
osteosarcoma -1.723 0.000
group 4 medulloblastoma 1.100 0.006
spina bifida -1.215 0.040
ovarian cancer 1.300 0.000
pituitary cancer 1.100 0.000

Synonym

Accession Q96B23 A8K123 A8KAB6 Q5XG78 Q6N058 Q86TB5 Q8TCQ5
Symbols ARKL1
RNF111L1

Gene

  Ortholog (4)

Species Source
Macaque OMA Inparanoid
Chicken OMA Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid

Gene RIF (2)

PMID Text
24216761 ARKL1 binds CK2beta through the KSSR motif and this involves a polyserine sequence resembling the CK2beta binding sequence in EBNA1.
19240061 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MKMEEAVGKVEELIESEAPPKASEQETAKEEDGSVELESQVQKDGVADSTVISSMPCLLMELRRDSSESQ      1 - 70
LASTESDKPTTGRVYESDSSNHCMLSPSSSGHLADSDTLSSAEENEPSQAETAVEGDPSGVSGATVGRKS     71 - 140
RRSRSESETSTMAAKKNRQSSDKQNGRVAKVKGHRSQKHKERIRLLRQKREAAARKKYNLLQDSSTSDSD    141 - 210
LTCDSSTSSSDDDEEVSGSSKTITAEIPDGPPVVAHYDMSDTNSDPEVVNVDNLLAAAVVQEHSNSVGGQ    211 - 280
DTGATWRTSGLLEELNAEAGHLDPGFLASDKTSGNAPLNEEINIASSDSEVEIVGVQEHARCVHPRGGVI    281 - 350
QSVSSWKHGSGTQYVSTRQTQSWTAVTPQQTWASPAEVVDLTLDEDSRRKYLL                     351 - 403
//

Text Mined References (20)

PMID Year Title
24216761 2014 Identification of a novel protein interaction motif in the regulatory subunit of casein kinase 2.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
More...