Property Summary

NCBI Gene PubMed Count 12
PubMed Score 3.99
PubTator Score 2.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
ductal carcinoma in situ 1.400 1.1e-02
fibroadenoma 1.700 4.0e-02
interstitial cystitis -2.600 8.9e-04
intraductal papillary-mucinous adenoma (... 2.300 3.2e-03
intraductal papillary-mucinous carcinoma... 2.100 3.8e-03
intraductal papillary-mucinous neoplasm ... 2.700 3.2e-05
invasive ductal carcinoma 2.800 2.1e-02
lung adenocarcinoma 1.100 2.8e-05
lung carcinoma 1.600 4.5e-09
nasopharyngeal carcinoma -2.100 2.3e-08
non-small cell lung carcinoma 1.300 5.8e-10
osteosarcoma -1.764 4.7e-05
ovarian cancer 1.200 3.1e-04
pancreatic cancer 1.300 6.6e-04
pituitary cancer -1.600 1.6e-03
primary pancreatic ductal adenocarcinoma 1.540 2.2e-02
psoriasis 2.100 6.2e-55
sarcoidosis -1.100 6.8e-03
spina bifida -1.638 4.8e-02
tuberculosis -1.600 3.6e-04

Gene RIF (4)

AA Sequence

MANFKGHALPGSFFLIIGLCWSVKYPLKYFSHTRKNSPLHYYQRLEIVEAAIRTLFSVTGILAEQFVPDG      1 - 70
PHLHLYHENHWIKLMNWQHSTMYLFFAVSGIVDMLTYLVSHVPLGVDRLVMAVAVFMEGFLFYYHVHNRP     71 - 140
PLDQHIHSLLLYALFGGCVSISLEVIFRDHIVLELFRTSLIILQGTWFWQIGFVLFPPFGTPEWDQKDDA    141 - 210
NLMFITMCFCWHYLAALSIVAVNYSLVYCLLTRMKRHGRGEIIGIQKLNSDDTYQTALLSGSDEE         211 - 275
//

Text Mined References (13)

PMID Year Title