Property Summary

NCBI Gene PubMed Count 10
PubMed Score 3.16
PubTator Score 2.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 1.05144954271559E-17
non-small cell lung carcinoma 413 5.82526481109876E-10
nasopharyngeal carcinoma 1056 3.17488840422063E-9
lung carcinoma 2844 4.47367592377819E-9
lung adenocarcinoma 2714 8.2773451229649E-6
pancreatic cancer 2300 2.39031880103893E-5
osteosarcoma 7933 4.71838097389985E-5
ovarian cancer 8492 3.07307928337733E-4
tuberculosis 1563 3.61785801689613E-4
interstitial cystitis 2299 8.74631780899871E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00107717072049739
pituitary cancer 1972 0.00161528825053532
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00315168949588292
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00407313925065581
ductal carcinoma in situ 1745 0.00608874537950169
sarcoidosis 368 0.00678414607450904
invasive ductal carcinoma 2950 0.0210463588409176
primary pancreatic ductal adenocarcinoma 1271 0.0221650672440075
spina bifida 1064 0.0390702555863645
fibroadenoma 557 0.0401734384078408

Expression

Synonym

Accession Q96B21 A8K2L8
Symbols

Gene

  Ortholog (11)

Gene RIF (2)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19773279 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MANFKGHALPGSFFLIIGLCWSVKYPLKYFSHTRKNSPLHYYQRLEIVEAAIRTLFSVTGILAEQFVPDG      1 - 70
PHLHLYHENHWIKLMNWQHSTMYLFFAVSGIVDMLTYLVSHVPLGVDRLVMAVAVFMEGFLFYYHVHNRP     71 - 140
PLDQHIHSLLLYALFGGCVSISLEVIFRDHIVLELFRTSLIILQGTWFWQIGFVLFPPFGTPEWDQKDDA    141 - 210
NLMFITMCFCWHYLAALSIVAVNYSLVYCLLTRMKRHGRGEIIGIQKLNSDDTYQTALLSGSDEE         211 - 275
//

Text Mined References (11)

PMID Year Title
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22383897 2012 Genome-wide association study in east Asians identifies novel susceptibility loci for breast cancer.
22238593 2012 A genome-wide association search for type 2 diabetes genes in African Americans.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...