Property Summary

NCBI Gene PubMed Count 4
PubMed Score 50.63
PubTator Score 105.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Polycystic Ovary Syndrome 335
Disease Target Count P-value
psoriasis 6685 1.44222093039954E-51
astrocytoma 1493 6.70892827231161E-21
oligodendroglioma 2849 4.49318294773929E-19
ependymoma 2514 2.16852065619528E-11
atypical teratoid / rhabdoid tumor 4369 1.1891715864131E-8
medulloblastoma 1524 8.05087550091263E-7
pediatric high grade glioma 2712 3.70876808964449E-5
medulloblastoma, large-cell 6234 1.20905589746602E-4
osteosarcoma 7933 1.24461324633285E-4
glioblastoma 5572 2.19776838662787E-4
primitive neuroectodermal tumor 3031 0.00565997809005588
Disease Target Count Z-score Confidence
Placenta praevia 9 3.305 1.7

Expression

  Differential Expression (11)

Disease log2 FC p
ependymoma -2.100 0.000
astrocytoma -1.100 0.000
glioblastoma -2.200 0.000
oligodendroglioma -1.100 0.000
osteosarcoma 2.176 0.000
medulloblastoma -2.000 0.000
atypical teratoid / rhabdoid tumor -2.700 0.000
medulloblastoma, large-cell -3.100 0.000
primitive neuroectodermal tumor -1.600 0.006
pediatric high grade glioma -1.900 0.000
psoriasis -1.100 0.000

Synonym

Accession Q96B18
Symbols RRR1
DAPPER3

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG
Pig OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid

Pathway (1)

Gene RIF (1)

PMID Text
18538736 Epigenetic repression of DACT3 leads to aberrant Wnt-beta-catenin signaling in colorectal cancer cells.

AA Sequence

MIRAFSFPVSPERGRLRGWLEGSLAGLCELHWLRERQEYRVQQALRLAQPGMGGAEAEDEEDADEDEDAA      1 - 70
AARRAAAALEEQLEALPGLVWDLGQQLGDLSLESGGLEQESGRSSGFYEDPSSTGGPDSPPSTFCGDSGF     71 - 140
SGSSSYGRLGPSEPRGIYASERPKSLGDASPSAPEVVGARAAVPRSFSAPYPTAGGSAGPEACSSAERRA    141 - 210
RAGPFLTPSPLHAVAMRSPRPCGRPPTDSPDAGGAGRPLDGYISALLRRRRRRGAGQPRTSPGGADGGPR    211 - 280
RQNSVRQRPPDASPSPGSARPAREPSLERVGGHPTSPAALSRAWASSWESEAAPEPAAPPAAPSPPDSPA    281 - 350
EGRLVKAQYIPGAQAATRGLPGRAARRKPPPLTRGRSVEQSPPRERPRAAGRRGRMAEASGRRGSPRARK    351 - 420
ASRSQSETSLLGRASAVPSGPPKYPTAEREEPRPPRPRRGPAPTLAAQAAGSCRRWRSTAEIDAADGRRV    421 - 490
RPRAPAARVPGPGPSPSAPQRRLLYGCAGSDSECSAGRLGPLGRRGPAGGVGGGYGESESSASEGESPAF    491 - 560
SSASSDSDGSGGLVWPQQLVAATAASGGGAGAGAPAGPAKVFVKIKASHALKKKILRFRSGSLKVMTTV     561 - 629
//

Text Mined References (5)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
18538736 2008 DACT3 is an epigenetic regulator of Wnt/beta-catenin signaling in colorectal cancer and is a therapeutic target of histone modifications.
16881060 2006 Three Dact gene family members are expressed during embryonic development and in the adult brains of mice.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.