Property Summary

NCBI Gene PubMed Count 4
PubMed Score 56.79
PubTator Score 105.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.900 1.8e-04
astrocytoma -1.100 6.7e-21
atypical teratoid / rhabdoid tumor -2.700 1.2e-08
ependymoma -1.500 4.5e-02
glioblastoma -1.500 3.0e-06
group 3 medulloblastoma -1.800 2.9e-03
medulloblastoma, large-cell -3.100 1.2e-04
oligodendroglioma -1.100 4.5e-19
osteosarcoma 2.176 1.2e-04
primitive neuroectodermal tumor -1.600 5.7e-03
psoriasis -1.100 1.4e-51

Synonym

Accession Q96B18
Symbols RRR1
DAPPER3

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (5)

Gene RIF (1)

AA Sequence

MIRAFSFPVSPERGRLRGWLEGSLAGLCELHWLRERQEYRVQQALRLAQPGMGGAEAEDEEDADEDEDAA      1 - 70
AARRAAAALEEQLEALPGLVWDLGQQLGDLSLESGGLEQESGRSSGFYEDPSSTGGPDSPPSTFCGDSGF     71 - 140
SGSSSYGRLGPSEPRGIYASERPKSLGDASPSAPEVVGARAAVPRSFSAPYPTAGGSAGPEACSSAERRA    141 - 210
RAGPFLTPSPLHAVAMRSPRPCGRPPTDSPDAGGAGRPLDGYISALLRRRRRRGAGQPRTSPGGADGGPR    211 - 280
RQNSVRQRPPDASPSPGSARPAREPSLERVGGHPTSPAALSRAWASSWESEAAPEPAAPPAAPSPPDSPA    281 - 350
EGRLVKAQYIPGAQAATRGLPGRAARRKPPPLTRGRSVEQSPPRERPRAAGRRGRMAEASGRRGSPRARK    351 - 420
ASRSQSETSLLGRASAVPSGPPKYPTAEREEPRPPRPRRGPAPTLAAQAAGSCRRWRSTAEIDAADGRRV    421 - 490
RPRAPAARVPGPGPSPSAPQRRLLYGCAGSDSECSAGRLGPLGRRGPAGGVGGGYGESESSASEGESPAF    491 - 560
SSASSDSDGSGGLVWPQQLVAATAASGGGAGAGAPAGPAKVFVKIKASHALKKKILRFRSGSLKVMTTV     561 - 629
//

Text Mined References (5)

PMID Year Title