Property Summary

NCBI Gene PubMed Count 20
Grant Count 4
Funding $347,326.5
PubMed Score 7.01
PubTator Score 10.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Rheumatoid Arthritis 2.500 0.011
astrocytic glioma -2.200 0.044
oligodendroglioma -2.100 0.049
osteosarcoma -2.333 0.000
atypical teratoid / rhabdoid tumor -2.100 0.000
glioblastoma -1.700 0.000
medulloblastoma -1.800 0.000
medulloblastoma, large-cell -2.100 0.001
primitive neuroectodermal tumor -1.300 0.001
juvenile dermatomyositis 1.057 0.000
acute quadriplegic myopathy 1.253 0.000
Breast cancer 2.400 0.034
adult high grade glioma -1.200 0.011
invasive ductal carcinoma 1.200 0.001
ovarian cancer 1.400 0.004

Synonym

Accession Q96B02 B4DIV1 Q1XBE0 Q9H823 Q9HAG6 Q9NV07
Symbols UBC16
UBC-16

Gene

PDB

2A7L   2MT6  

Gene RIF (5)

PMID Text
26101372 TRIM5alpha requires Ube2W to anchor Lys63-linked ubiquitin chains and restrict reverse transcription.
25436519 We show the ubequitin-conjugating enzyme (E2) Ube2w uses a unique mechanism to facilitate the specific ubiquitination of the alpha-amino group
23696636 Ube2w has novel enzymatic properties that direct ubiquitination of the N terminus of substrates
21229326 UBE2W regulates FANCD2 monoubiquitination by mechanisms different from UBE2T and HRR6.
16368532 human Ubiquitin-conjugating enzyme (E2) is homologous to the Arabidopsis thaliana UBC-16 gene product and contains 2 nuclear localization signals

AA Sequence

MASMQKRLQKELLALQNDPPPGMTLNEKSVQNSITQWIVDMEGAPGTLYEGEKFQLLFKFSSRYPFDSPQ      1 - 70
VMFTGENIPVHPHVYSNGHICLSILTEDWSPALSVQSVCLSIISMLSSCKEKRRPPDNSFYVRTCNKNPK     71 - 140
KTKWWYHDDTC                                                               141 - 151
//

Text Mined References (23)

PMID Year Title
26101372 2015 TRIM5? requires Ube2W to anchor Lys63-linked ubiquitin chains and restrict reverse transcription.
25436519 2015 Intrinsic disorder drives N-terminal ubiquitination by Ube2w.
25416956 2014 A proteome-scale map of the human interactome network.
23696636 2013 The ubiquitin-conjugating enzyme (E2) Ube2w ubiquitinates the N terminus of substrates.
23560854 2013 Ube2W conjugates ubiquitin to ?-amino groups of protein N-termini.
22496338 2012 A human ubiquitin conjugating enzyme (E2)-HECT E3 ligase structure-function screen.
22157707 2011 Profiling of autoantibodies in IgA nephropathy, an integrative antibiomics approach.
21855799 2011 Ube2w and ataxin-3 coordinately regulate the ubiquitin ligase CHIP.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21229326 2011 UBE2W interacts with FANCL and regulates the monoubiquitination of Fanconi anemia protein FANCD2.
More...