Property Summary

NCBI Gene PubMed Count 20
PubMed Score 7.31
PubTator Score 10.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
acute quadriplegic myopathy 1.253 5.2e-05
adult high grade glioma -1.200 1.1e-02
astrocytic glioma -2.200 4.4e-02
atypical teratoid / rhabdoid tumor -1.100 7.3e-03
Breast cancer 2.400 3.4e-02
glioblastoma -1.700 5.1e-05
group 4 medulloblastoma -1.400 3.5e-03
invasive ductal carcinoma 1.200 1.2e-03
juvenile dermatomyositis 1.057 3.9e-08
medulloblastoma, large-cell -1.100 1.1e-02
oligodendroglioma -2.100 4.9e-02
osteosarcoma 1.870 1.6e-05
ovarian cancer 1.400 4.2e-03
primitive neuroectodermal tumor -1.300 1.3e-03
Rheumatoid arthritis 2.500 1.1e-02

Gene RIF (5)

AA Sequence

MASMQKRLQKELLALQNDPPPGMTLNEKSVQNSITQWIVDMEGAPGTLYEGEKFQLLFKFSSRYPFDSPQ      1 - 70
VMFTGENIPVHPHVYSNGHICLSILTEDWSPALSVQSVCLSIISMLSSCKEKRRPPDNSFYVRTCNKNPK     71 - 140
KTKWWYHDDTC                                                               141 - 151
//

Text Mined References (23)

PMID Year Title