Property Summary

NCBI Gene PubMed Count 23
Grant Count 28
R01 Count 3
Funding $6,051,696.53
PubMed Score 38.71
PubTator Score 39.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
psoriasis -2.800 0.000
glioblastoma 1.400 0.000
osteosarcoma 1.871 0.016
atypical teratoid / rhabdoid tumor 1.600 0.001
non-small cell lung cancer 1.093 0.000
lung cancer 1.400 0.002
pediatric high grade glioma 1.200 0.001
pilocytic astrocytoma 1.800 0.000
posterior fossa group A ependymoma 1.200 0.000
sonic hedgehog group medulloblastoma 1.600 0.000
pituitary cancer -1.200 0.010

Pathway (1)

Gene RIF (13)

PMID Text
25510505 Mutations in the HSP47 and FKBP65 produce a moderately severe form of Osteogenesis imperfect.
24467213 CTSD, FKBP10, and SLC2A1 are novel genes that participate in the acquisition and maintenance of the adriamycin-resistant phenotype in leukemia cells.
24106871 Elastin binding protein and FKBP65 modulate the kinetics of self-assembly of tropoelastin in an in vitro system.
23712425 Results imply that FKBP10 mutations affect collagen indirectly, by ablating FKBP65 support for collagen telopeptide hydroxylation by lysyl hydroxylase 2, thus decreasing collagen cross-links in tendon and bone matrix.
23434032 FKBP10 depletion enhances glucocerebrosidase proteostasis in Gaucher disease fibroblasts
23354471 underexpression of FKBP65 protein is characteristic of high-grade serous carcinomas and this expression profile may be linked to molecular pathways associated with an unfavourable outcome in cancer patients.
22949511 FKBP10 acts during procollagen maturation to contribute to molecular stability and post-translational modification of type I procollagen, without which bone mass and quality are abnormal and fractures and contractures result
22718341 identified a Palestinian pedigree with moderate and lethal forms of recessive OI caused by mutations in FKBP10 or PPIB, which encode endoplasmic reticulum resident chaperone/isomerases FKBP65 and CyPB, respectively
22107750 Homozygosity mapping identified FKBP10 as a candidate gene, and sequencing revealed a base pair exchange that causes a C-terminal premature stop codon in this gene.
21567934 Mutations in FKBP10 cause both Bruck syndrome and isolated osteogenesis imperfecta in humans.
More...

AA Sequence

MFPAGPPSHSLLRLPLLQLLLLVVQAVGRGLGRASPAGGPLEDVVIERYHIPRACPREVQMGDFVRYHYN      1 - 70
GTFEDGKKFDSSYDRNTLVAIVVGVGRLITGMDRGLMGMCVNERRRLIVPPHLGYGSIGLAGLIPPDATL     71 - 140
YFDVVLLDVWNKEDTVQVSTLLRPPHCPRMVQDGDFVRYHYNGTLLDGTSFDTSYSKGGTYDTYVGSGWL    141 - 210
IKGMDQGLLGMCPGERRKIIIPPFLAYGEKGYGTVIPPQASLVFHVLLIDVHNPKDAVQLETLELPPGCV    211 - 280
RRAGAGDFMRYHYNGSLMDGTLFDSSYSRNHTYNTYIGQGYIIPGMDQGLQGACMGERRRITIPPHLAYG    281 - 350
ENGTGDKIPGSAVLIFNVHVIDFHNPADVVEIRTLSRPSETCNETTKLGDFVRYHYNCSLLDGTQLFTSH    351 - 420
DYGAPQEATLGANKVIEGLDTGLQGMCVGERRQLIVPPHLAHGESGARGVPGSAVLLFEVELVSREDGLP    421 - 490
TGYLFVWHKDPPANLFEDMDLNKDGEVPPEEFSTFIKAQVSEGKGRLMPGQDPEKTIGDMFQNQDRNQDG    491 - 560
KITVDELKLKSDEDEERVHEEL                                                    561 - 582
//

Text Mined References (28)

PMID Year Title
25510505 2015 HSP47 and FKBP65 cooperate in the synthesis of type I procollagen.
24467213 2014 Identification of chemoresistance-related cell-surface glycoproteins in leukemia cells and functional validation of candidate glycoproteins.
24106871 2013 Elastin binding protein and FKBP65 modulate in vitro self-assembly of human tropoelastin.
23712425 2013 Kuskokwim syndrome, a recessive congenital contracture disorder, extends the phenotype of FKBP10 mutations.
23434032 2013 FKBP10 depletion enhances glucocerebrosidase proteostasis in Gaucher disease fibroblasts.
23354471 2013 FKBP10/FKBP65 expression in high-grade ovarian serous carcinoma and its association with patient outcome.
22949511 2013 Mutations in FKBP10, which result in Bruck syndrome and recessive forms of osteogenesis imperfecta, inhibit the hydroxylation of telopeptide lysines in bone collagen.
22718341 2012 Absence of FKBP10 in recessive type XI osteogenesis imperfecta leads to diminished collagen cross-linking and reduced collagen deposition in extracellular matrix.
22107750 2011 Mutations in FKBP10 can cause a severe form of isolated Osteogenesis imperfecta.
21567934 2011 Mutations in FKBP10 cause both Bruck syndrome and isolated osteogenesis imperfecta in humans.
More...