Property Summary

NCBI Gene PubMed Count 28
Grant Count 51
R01 Count 38
Funding $4,246,921.97
PubMed Score 46.05
PubTator Score 30.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
pancreatic cancer 1.600 0.010
astrocytic glioma -2.800 0.044
glioblastoma multiforme 1.300 0.000
osteosarcoma -4.119 0.000
atypical teratoid / rhabdoid tumor -1.200 0.004
medulloblastoma, large-cell -1.700 0.000
active Crohn's disease 1.128 0.034
Breast cancer 2.800 0.025
interstitial cystitis 1.100 0.001
group 3 medulloblastoma 2.200 0.012
pancreatic carcinoma 1.600 0.010
lung adenocarcinoma 1.100 0.000
COPD 1.200 0.020
ductal carcinoma in situ 1.200 0.008
invasive ductal carcinoma 2.000 0.002
ovarian cancer 2.400 0.000

Gene RIF (24)

PMID Text
25496524 HIV-1 Vpr-mediated cell cycle G2/M arrest requires human SLX4, MUS81, and EME1 proteins in cells
25496524 HIV-1 Vpr-mediated cell cycle G2/M arrest requires human SLX4, MUS81, and EME1 proteins in cells
25496524 HIV-1 Vpr-mediated cell cycle G2/M arrest requires human SLX4, MUS81, and EME1 proteins in cells
25320300 HIV-1 Vpr-mediated cell cycle G2/M arrest requires human SLX4, MUS81, and EME1 proteins in cells
24795708 HIV-1 Vpr-mediated cell cycle G2/M arrest requires human SLX4, MUS81, and EME1 proteins in cells
24744753 HIV-1 Vpr-mediated cell cycle G2/M arrest requires human SLX4, MUS81, and EME1 proteins in cells
24733841 While Mus81-Eme1 shares several common features with members of the 5' flap nuclease family, the combined structural, biochemical, and biophysical analyses explain why Mus81-Eme1 preferentially cleaves 3' flap DNA substrates with 5' nicked ends.
24528857 HIV-1 Vpr-mediated cell cycle G2/M arrest requires human SLX4, MUS81, and EME1 proteins in cells
24528857 HIV-1 Vpr-mediated cell cycle G2/M arrest requires human SLX4, MUS81, and EME1 proteins in cells
24412650 HIV-1 Vpr-mediated cell cycle G2/M arrest requires human SLX4, MUS81, and EME1 proteins in cells
More...

AA Sequence

MALKKSSPSLDSGDSDSEELPTFAFLKKEPSSTKRRQPEREEKIVVVDISDCEASCPPAPELFSPPVPEI      1 - 70
AETVTQTQPVRLLSSESEDEEEFIPLAQRLTCKFLTHKQLSPEDSSSPVKSVLDHQNNEGASCDWKKPFP     71 - 140
KIPEVPLHDTPERSAADNKDLILDPCCQLPAYLSTCPGQSSSLAVTKTNSDILPPQKKTKPSQKVQGRGS    141 - 210
HGCRQQRQARQKESTLRRQERKNAALVTRMKAQRPEECLKHIIVVLDPVLLQMEGGGQLLGALQTMECRC    211 - 280
VIEAQAVPCSVTWRRRAGPSEDREDWVEEPTVLVLLRAEAFVSMIDNGKQGSLDSTMKGKETLQGFVTDI    281 - 350
TAKTAGKALSLVIVDQEKCFSAQNPPRRGKQGANKQTKKQQQRQPEASIGSMVSRVDAEEALVDLQLHTE    351 - 420
AQAQIVQSWKELADFTCAFTKAVAEAPFKKLRDETTFSFCLESDWAGGVKVDLAGRGLALVWRRQIQQLN    421 - 490
RVSLEMASAVVNAYPSPQLLVQAYQQCFSDKERQNLLADIQVRRGEGVTSTSRRIGPELSRRIYLQMTTL    491 - 560
QPHLSLDSAD                                                                561 - 570
//

Text Mined References (36)

PMID Year Title
24733841 2014 Crystal structures of the structure-selective nuclease Mus81-Eme1 bound to flap DNA substrates.
24076221 2013 Coordinated actions of SLX1-SLX4 and MUS81-EME1 for Holliday junction resolution in human cells.
23361013 2013 FBH1 co-operates with MUS81 in inducing DNA double-strand breaks and cell death following replication stress.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21859861 2011 Wee1 controls genomic stability during replication by regulating the Mus81-Eme1 endonuclease.
21858151 2011 Structure-specific DNA endonuclease Mus81/Eme1 generates DNA damage caused by Chk1 inactivation.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20610542 2010 Gamma-radiation sensitivity and polymorphisms in RAD51L1 modulate glioma risk.
20522537 2010 Variation within DNA repair pathway genes and risk of multiple sclerosis.
More...