Property Summary

NCBI Gene PubMed Count 17
PubMed Score 10.26
PubTator Score 8.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -1.500 1.5e-02
astrocytic glioma -1.100 2.4e-02
Astrocytoma, Pilocytic -2.000 2.5e-05
atypical teratoid / rhabdoid tumor -2.200 1.1e-06
ependymoma -1.400 1.2e-02
glioblastoma -1.900 6.3e-06
group 3 medulloblastoma -3.000 9.9e-04
head and neck cancer -1.300 2.7e-02
medulloblastoma, large-cell -2.400 1.8e-03
nasopharyngeal carcinoma -1.200 2.7e-05
oligodendroglioma -1.400 9.0e-03
osteosarcoma -4.687 7.4e-09
primitive neuroectodermal tumor -2.100 1.0e-02
subependymal giant cell astrocytoma -2.092 1.7e-02
tuberculosis 1.900 1.1e-07

Gene RIF (6)

AA Sequence

MTGTPGAVATRDGEAPERSPPCSPSYDLTGKVMLLGDTGVGKTCFLIQFKDGAFLSGTFIATVGIDFRNK      1 - 70
VVTVDGVRVKLQIWDTAGQERFRSVTHAYYRDAQALLLLYDITNKSSFDNIRAWLTEIHEYAQRDVVIML     71 - 140
LGNKADMSSERVIRSEDGETLAREYGVPFLETSAKTGMNVELAFLAIAKELKYRAGHQADEPSFQIRDYV    141 - 210
ESQKKRSSCCSFM                                                             211 - 223
//

Text Mined References (18)

PMID Year Title