Property Summary

NCBI Gene PubMed Count 16
PubMed Score 8.11
PubTator Score 8.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
osteosarcoma 7933 7.38139798486334E-9
tuberculosis 1563 1.12018892259514E-7
posterior fossa group B ependymoma 1530 1.759760562785E-7
atypical teratoid/rhabdoid tumor 1095 4.17480050449902E-7
glioblastoma 5572 6.30917280266656E-6
pilocytic astrocytoma 3086 1.19176902658952E-5
nasopharyngeal carcinoma 1056 2.7482837408428E-5
pediatric high grade glioma 2712 6.83052365424141E-5
group 3 medulloblastoma 2254 9.93391710612342E-4
medulloblastoma, large-cell 6234 0.00184979087185159
oligodendroglioma 2849 0.00903143147471951
primitive neuroectodermal tumor 3031 0.00996081276147576
subependymal giant cell astrocytoma 2287 0.0172741396681642
astrocytic glioma 2241 0.0236265037924266
head and neck cancer 270 0.0270486022853062
Disease Target Count Z-score Confidence
Atherosclerosis 275 0.0 2.0

Expression

  Differential Expression (15)

Synonym

Accession Q96AX2 A8MXF5 A8MYT0 Q8IWA7
Symbols

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum EggNOG Inparanoid
Platypus OMA EggNOG

 GWAS Trait (1)

Gene RIF (5)

PMID Text
25183545 RAB37 regulates the exocytosis of TIMP1 in a nucleotide-dependent manner to inactivate MMP9 migration axis in vitro and in vivo and to suppress tumor metastasis.
23372429 Rab37 mRNA was specifically expressed in some ESCC cell lines but its genetic polymorphisms were not associated with esophageal squamous cell carcinoma.
22082156 Knockdown of RAB37, member RAS oncogene family by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N
19148500 the TMEM22/RAB37 complex is likely to play a crucial role in growth of renal cell carcinoma
18687502 Promoter/exon1 methylation is the predominant mechanism in down-regulation of the hRAB37, and can serve as a potential prediction biomarker of NSCLC progression.

AA Sequence

MTGTPGAVATRDGEAPERSPPCSPSYDLTGKVMLLGDTGVGKTCFLIQFKDGAFLSGTFIATVGIDFRNK      1 - 70
VVTVDGVRVKLQIWDTAGQERFRSVTHAYYRDAQALLLLYDITNKSSFDNIRAWLTEIHEYAQRDVVIML     71 - 140
LGNKADMSSERVIRSEDGETLAREYGVPFLETSAKTGMNVELAFLAIAKELKYRAGHQADEPSFQIRDYV    141 - 210
ESQKKRSSCCSFM                                                             211 - 223
//

Text Mined References (17)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25183545 2014 Small GTPase Rab37 targets tissue inhibitor of metalloproteinase 1 for exocytosis and thus suppresses tumour metastasis.
23969696 2013 Multiethnic meta-analysis of genome-wide association studies in >100 000 subjects identifies 23 fibrinogen-associated Loci but no strong evidence of a causal association between circulating fibrinogen and cardiovascular disease.
23372429 2013 An association study on genetic polymorphisms of Rab37 gene with the risk of esophageal squamous cell carcinoma in a Chinese Han population.
20031577 2009 Novel loci, including those related to Crohn disease, psoriasis, and inflammation, identified in a genome-wide association study of fibrinogen in 17 686 women: the Women's Genome Health Study.
19148500 2009 Involvement of TMEM22 overexpression in the growth of renal cell carcinoma cells.
18687502 2009 Frequent down-regulation of hRAB37 in metastatic tumor by genetic and epigenetic mechanisms in lung cancer.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
More...