Property Summary

NCBI Gene PubMed Count 27
PubMed Score 9.42
PubTator Score 4.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
MUCOPOLYSACCHARIDOSIS-PLUS SYNDROME 1 0.0 0.0
Disease Target Count P-value
osteosarcoma 7950 9.1e-12
psoriasis 6694 6.5e-06
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Mucopolysaccharidosis 26 0.0 4.0

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -2.334 9.1e-12
psoriasis -3.100 6.5e-06

Gene RIF (7)

AA Sequence

MAAHLSYGRVNLNVLREAVRRELREFLDKCAGSKAIVWDEYLTGPFGLIAQYSLLKEHEVEKMFTLKGNR      1 - 70
LPAADVKNIIFFVRPRLELMDIIAENVLSEDRRGPTRDFHILFVPRRSLLCEQRLKDLGVLGSFIHREEY     71 - 140
SLDLIPFDGDLLSMESEGAFKECYLEGDQTSLYHAAKGLMTLQALYGTIPQIFGKGECARQVANMMIRMK    141 - 210
REFTGSQNSIFPVFDNLLLLDRNVDLLTPLATQLTYEGLIDEIYGIQNSYVKLPPEKFAPKKQGDGGKDL    211 - 280
PTEAKKLQLNSAEELYAEIRDKNFNAVGSVLSKKAKIISAAFEERHNAKTVGEIKQFVSQLPHMQAARGS    281 - 350
LANHTSIAELIKDVTTSEDFFDKLTVEQEFMSGIDTDKVNNYIEDCIAQKHSLIKVLRLVCLQSVCNSGL    351 - 420
KQKVLDYYKREILQTYGYEHILTLHNLEKAGLLKPQTGGRNNYPTIRKTLRLWMDDVNEQNPTDISYVYS    421 - 490
GYAPLSVRLAQLLSRPGWRSIEEVLRILPGPHFEERQPLPTGLQKKRQPGENRVTLIFFLGGVTFAEIAA    491 - 560
LRFLSQLEDGGTEYVIATTKLMNGTSWIEALMEKPF                                      561 - 596
//

Text Mined References (31)

PMID Year Title