Property Summary

NCBI Gene PubMed Count 20
Grant Count 6
Funding $3,010,556.67
PubMed Score 9.39
PubTator Score 4.33

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis -3.100 0.000
osteosarcoma -2.334 0.000

Gene RIF (4)

PMID Text
25783203 association of VPS33A with HOPS via its interaction with VPS16 is required for both endosome- and autophagosome-lysosome fusion
22203954 Melanoma cells depleted of vacuolar protein sorting 33A protein have increased nuclear localization of cis-diaminedichloroplatinum II, increased nuclear DNA damage by platination, and increased apoptosis, resulting in increased treatment sensitivity.
15790593 A and B classes reflect the evolution of organelle/tissue-specific functions
12538872 VPS33A is mutated in Hermansky-Pudlak syndrome and may have a role in melanogenesis

AA Sequence

MAAHLSYGRVNLNVLREAVRRELREFLDKCAGSKAIVWDEYLTGPFGLIAQYSLLKEHEVEKMFTLKGNR      1 - 70
LPAADVKNIIFFVRPRLELMDIIAENVLSEDRRGPTRDFHILFVPRRSLLCEQRLKDLGVLGSFIHREEY     71 - 140
SLDLIPFDGDLLSMESEGAFKECYLEGDQTSLYHAAKGLMTLQALYGTIPQIFGKGECARQVANMMIRMK    141 - 210
REFTGSQNSIFPVFDNLLLLDRNVDLLTPLATQLTYEGLIDEIYGIQNSYVKLPPEKFAPKKQGDGGKDL    211 - 280
PTEAKKLQLNSAEELYAEIRDKNFNAVGSVLSKKAKIISAAFEERHNAKTVGEIKQFVSQLPHMQAARGS    281 - 350
LANHTSIAELIKDVTTSEDFFDKLTVEQEFMSGIDTDKVNNYIEDCIAQKHSLIKVLRLVCLQSVCNSGL    351 - 420
KQKVLDYYKREILQTYGYEHILTLHNLEKAGLLKPQTGGRNNYPTIRKTLRLWMDDVNEQNPTDISYVYS    421 - 490
GYAPLSVRLAQLLSRPGWRSIEEVLRILPGPHFEERQPLPTGLQKKRQPGENRVTLIFFLGGVTFAEIAA    491 - 560
LRFLSQLEDGGTEYVIATTKLMNGTSWIEALMEKPF                                      561 - 596
//

Text Mined References (25)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26463206 2015 Characterization of the Mammalian CORVET and HOPS Complexes and Their Modular Restructuring for Endosome Specificity.
25783203 2015 Recruitment of VPS33A to HOPS by VPS16 Is Required for Lysosome Fusion with Endosomes and Autophagosomes.
25266290 2014 Mammalian CORVET is required for fusion and conversion of distinct early endosome subpopulations.
24554770 2014 The HOPS complex mediates autophagosome-lysosome fusion through interaction with syntaxin 17.
23901104 2013 Structural basis of Vps33A recruitment to the human HOPS complex by Vps16.
23351085 2013 Tethering complexes in the endocytic pathway: CORVET and HOPS.
22203954 2012 Targeting protein-trafficking pathways alters melanoma treatment sensitivity.
21411634 2011 Clathrin-dependent mechanisms modulate the subcellular distribution of class C Vps/HOPS tether subunits in polarized and nonpolarized cells.
21269460 2011 Initial characterization of the human central proteome.
More...