Property Summary

NCBI Gene PubMed Count 24
PubMed Score 17.30
PubTator Score 17.19

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q96AW1 B0AZU1 B2RAT4 B3KS72 C9JWR3 Q6FIE3 Q8NBN8 Q96RE5 Q9H0W4
Symbols ECOP
GASP

Gene

 GO Function (1)

Gene RIF (7)

PMID Text
25398664 VOPP1 is overexpressed in gastric adenocarcinoma, which is involved in promoting cell proliferation and migration and thus might serve as a putative oncogene.
23243056 Upregulation of ECOP is associated with glioma.
21519330 overexpression in cancer participates in the control of the intracellular redox state; its loss leads to oxidative cellular injury leading to cell death by the intrinsic apoptotic pathway
20198315 Observational study of gene-disease association. (HuGE Navigator)
19851296 Observational study of gene-disease association. (HuGE Navigator)
19525979 Results identify ECOP as a protein relevant to the biology of SCC.
17515955 ECOP was used as a molecular marker in patients with chronic wounds to guide surgical debridement.

AA Sequence

MRRQPAKVAALLLGLLLECTEAKKHCWYFEGLYPTYYICRSYEDCCGSRCCVRALSIQRLWYFWFLLMMG      1 - 70
VLFCCGAGFFIRRRMYPPPLIEEPAFNVSYTRQPPNPGPGAQQPGPPYYTDPGGPGMNPVGNSMAMAFQV     71 - 140
PPNSPQGSVACPPPPAYCNTPPPPYEQVVKAK                                          141 - 172
//

Text Mined References (27)

PMID Year Title
25398664 2015 Epidermal growth factor receptor-coamplified and overexpressed protein (VOPP1) is a putative oncogene in gastric cancer.
23243056 2013 MiR-218 sensitizes glioma cells to apoptosis and inhibits tumorigenicity by regulating ECOP-mediated suppression of NF-?B activity.
21519330 2011 Loss of VOPP1 overexpression in squamous carcinoma cells induces apoptosis through oxidative cellular injury.
20571887 2010 Intracellular localization of GASP/ECOP/VOPP1.
20198315 2010 Association of genetic variants with hemorrhagic stroke in Japanese individuals.
19851296 2010 Assessment of a polymorphism of SDK1 with hypertension in Japanese Individuals.
19525979 2009 Combined genomic and gene expression microarray profiling identifies ECOP as an upregulated gene in squamous cell carcinomas independent of DNA amplification.
19505301 2009 Molecular signature of cell cycle exit induced in human T lymphoblasts by IL-2 withdrawal.
17515955 Molecular markers in patients with chronic wounds to guide surgical debridement.
16943533 2006 Increased epidermal growth factor receptor gene copy number is associated with poor prognosis in head and neck squamous cell carcinomas.
More...