Property Summary

NCBI Gene PubMed Count 26
PubMed Score 17.58
PubTator Score 17.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Gene RIF (8)

AA Sequence

MRRQPAKVAALLLGLLLECTEAKKHCWYFEGLYPTYYICRSYEDCCGSRCCVRALSIQRLWYFWFLLMMG      1 - 70
VLFCCGAGFFIRRRMYPPPLIEEPAFNVSYTRQPPNPGPGAQQPGPPYYTDPGGPGMNPVGNSMAMAFQV     71 - 140
PPNSPQGSVACPPPPAYCNTPPPPYEQVVKAK                                          141 - 172
//

Text Mined References (29)

PMID Year Title