Property Summary

NCBI Gene PubMed Count 26
Grant Count 9
R01 Count 9
Funding $899,478.16
PubMed Score 27.35
PubTator Score 21.17

Knowledge Summary

Patent

No data available

Expression

Gene RIF (18)

PMID Text
26397135 E2F7 overexpression leads to tamoxifen resistance in breast cancer by competing with E2F1 at miR-15a/16 promoter.
26018753 RacGAP1 Is a Novel Downstream Effector of E2F7-Dependent Resistance to Doxorubicin and Is Prognostic for Overall Survival in Squamous Cell Carcinoma
25708247 Findings indicate that miR-424 targets the E2F7 transcript and suppresses endometrial cancer cell growth. Knockdown of E2F7 inhibited Ishikawa and HEC-1B cell growth.
25411162 E2F7 directly increases the transcription and activity of the Sphk1/S1P axis resulting in activation of AKT and subsequent drug resistance.
23974101 E2F-7 can co-localize with gammaH2AX and 53BP1 in DNA damaged cells, bind directly to the recombining DNA, and, importantly, interact and recruit accessory factors, including CtBP and HDAC1 and 2, to the DSB.
23853115 E2F7 recruits the co-repressor C-terminal-binding protein (CtBP) and that CtBP2 is essential for E2F7 to repress E2F1 transcription.
23096114 MicroRNA-26a target E2F7 sustains cell proliferation and inhibits monocytic differentiation of acute myeloid leukemia cells.
23054209 Low E2F7 expression is associated with B-chronic lymphocytic leukemia.
22802529 identify a causal role for E2F7 in cellular senescence and uncover a novel link between the RB and p53 pathways.
22802528 E2F7-dependent mechanism contributes to p53-dependent cell cycle arrest in response to DNA damage.
More...

AA Sequence

MEVNCLTLKDLISPRQPRLDFAVEDGENAQKENIFVDRSRMAPKTPIKNEPIDLSKQKKFTPERNPITPV      1 - 70
KFVDRQQAEPWTPTANLKMLISAASPDIRDREKKKGLFRPIENKDDAFTDSLQLDVVGDSAVDEFEKQRP     71 - 140
SRKQKSLGLLCQKFLARYPSYPLSTEKTTISLDEVAVSLGVERRRIYDIVNVLESLHLVSRVAKNQYGWH    141 - 210
GRHSLPKTLRNLQRLGEEQKYEEQMAYLQQKELDLIDYKFGERKKDGDPDSQEQQLLDFSEPDCPSSSAN    211 - 280
SRKDKSLRIMSQKFVMLFLVSKTKIVTLDVAAKILIEESQDAPDHSKFKTKVRRLYDIANVLTSLALIKK    281 - 350
VHVTEERGRKPAFKWIGPVDFSSSDEELVDVSASVLPELKRETYGQIQVCAKQKLARHGSFNTVQASERI    351 - 420
QRKVNSEPSSPYREEQGSGGYSLEIGSLAAVYRQKIEDNSQGKAFASKRVVPPSSSLDPVAPFPVLSVDP    421 - 490
EYCVNPLAHPVFSVAQTDLQAFSMQNGLNGQVDVSLASAASAVESLKPALLAGQPLVYVPSASLFMLYGS    491 - 560
LQEGPASGSGSERDDRSSEAPATVELSSAPSAQKRLCEERKPQEEDEPATKRQSREYEDGPLSLVMPKKP    561 - 630
SDSTDLASPKTMGNRASIPLKDIHVNGQLPAAEEISGKATANSLVSSEWGNPSRNTDVEKPSKENESTKE    631 - 700
PSLLQYLCVQSPAGLNGFNVLLSGSQTPPTVGPSSGQLPSFSVPCMVLPSPPLGPFPVLYSPAMPGPVSS    701 - 770
TLGALPNTGPVNFSLPGLGSIAQLLVGPTAVVNPKSSTLPSADPQLQSQPSLNLSPVMSRSHSVVQQPES    771 - 840
PVYVGHPVSVVKLHQSPVPVTPKSIQRTHRETFFKTPGSLGDPVLKRRERNQSRNTSSAQRRLEIPSGGA    841 - 910
D//

Text Mined References (32)

PMID Year Title
26397135 2015 E2F7 overexpression leads to tamoxifen resistance in breast cancer cells by competing with E2F1 at miR-15a/16 promoter.
26018753 2015 RacGAP1 Is a Novel Downstream Effector of E2F7-Dependent Resistance to Doxorubicin and Is Prognostic for Overall Survival in Squamous Cell Carcinoma.
25708247 2015 MicroRNA-424 may function as a tumor suppressor in endometrial carcinoma cells by targeting E2F7.
25411162 2015 A novel E2F/sphingosine kinase 1 axis regulates anthracycline response in squamous cell carcinoma.
24057671 2014 Genome-wide association study of ancestry-specific TB risk in the South African Coloured population.
23974101 2013 E2F-7 couples DNA damage-dependent transcription with the DNA repair process.
23853115 2013 Interaction of E2F7 transcription factor with E2F1 and C-terminal-binding protein (CtBP) provides a mechanism for E2F7-dependent transcription repression.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23096114 2012 The microRNA-26a target E2F7 sustains cell proliferation and inhibits monocytic differentiation of acute myeloid leukemia cells.
23054209 2013 The non-genotoxic activator of the p53 pathway Nutlin-3 shifts the balance between E2F7 and E2F1 transcription factors in leukemic cells.
More...