Property Summary

NCBI Gene PubMed Count 27
PubMed Score 31.55
PubTator Score 21.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adult high grade glioma 2.700 5.2e-05
Atopic dermatitis 1.700 1.5e-05
atypical teratoid / rhabdoid tumor 3.500 5.4e-08
Breast cancer 3.500 4.1e-02
ductal carcinoma in situ 1.400 1.6e-02
Endometriosis 1.307 3.0e-02
ependymoma 3.100 2.8e-09
glioblastoma 3.300 3.7e-10
group 3 medulloblastoma 3.100 1.9e-09
intraductal papillary-mucinous carcinoma... 2.700 3.2e-04
intraductal papillary-mucinous neoplasm ... 4.000 2.5e-04
invasive ductal carcinoma 1.500 1.4e-02
medulloblastoma, large-cell 3.100 4.8e-05
non primary Sjogren syndrome sicca -1.200 2.4e-02
non-small cell lung cancer 2.063 2.1e-16
ovarian cancer 2.100 4.2e-04
primitive neuroectodermal tumor 3.700 1.0e-07
psoriasis 1.600 4.7e-95

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (19)

AA Sequence

MEVNCLTLKDLISPRQPRLDFAVEDGENAQKENIFVDRSRMAPKTPIKNEPIDLSKQKKFTPERNPITPV      1 - 70
KFVDRQQAEPWTPTANLKMLISAASPDIRDREKKKGLFRPIENKDDAFTDSLQLDVVGDSAVDEFEKQRP     71 - 140
SRKQKSLGLLCQKFLARYPSYPLSTEKTTISLDEVAVSLGVERRRIYDIVNVLESLHLVSRVAKNQYGWH    141 - 210
GRHSLPKTLRNLQRLGEEQKYEEQMAYLQQKELDLIDYKFGERKKDGDPDSQEQQLLDFSEPDCPSSSAN    211 - 280
SRKDKSLRIMSQKFVMLFLVSKTKIVTLDVAAKILIEESQDAPDHSKFKTKVRRLYDIANVLTSLALIKK    281 - 350
VHVTEERGRKPAFKWIGPVDFSSSDEELVDVSASVLPELKRETYGQIQVCAKQKLARHGSFNTVQASERI    351 - 420
QRKVNSEPSSPYREEQGSGGYSLEIGSLAAVYRQKIEDNSQGKAFASKRVVPPSSSLDPVAPFPVLSVDP    421 - 490
EYCVNPLAHPVFSVAQTDLQAFSMQNGLNGQVDVSLASAASAVESLKPALLAGQPLVYVPSASLFMLYGS    491 - 560
LQEGPASGSGSERDDRSSEAPATVELSSAPSAQKRLCEERKPQEEDEPATKRQSREYEDGPLSLVMPKKP    561 - 630
SDSTDLASPKTMGNRASIPLKDIHVNGQLPAAEEISGKATANSLVSSEWGNPSRNTDVEKPSKENESTKE    631 - 700
PSLLQYLCVQSPAGLNGFNVLLSGSQTPPTVGPSSGQLPSFSVPCMVLPSPPLGPFPVLYSPAMPGPVSS    701 - 770
TLGALPNTGPVNFSLPGLGSIAQLLVGPTAVVNPKSSTLPSADPQLQSQPSLNLSPVMSRSHSVVQQPES    771 - 840
PVYVGHPVSVVKLHQSPVPVTPKSIQRTHRETFFKTPGSLGDPVLKRRERNQSRNTSSAQRRLEIPSGGA    841 - 910
D//

Text Mined References (33)

PMID Year Title