Property Summary

NCBI Gene PubMed Count 17
PubMed Score 101.96
PubTator Score 115.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
medulloblastoma, large-cell -1.200 0.000
intraductal papillary-mucinous neoplasm ... 1.700 0.041
lung cancer 1.500 0.000
group 4 medulloblastoma -1.100 0.025
nasopharyngeal carcinoma 1.100 0.001
ovarian cancer 1.800 0.001

Synonym

Gene

RPE

PDB

3OVP   3OVQ   3OVR   3QC3  

 GWAS Trait (1)

Gene RIF (1)

PMID Text
20923965 The binary complexes of RPE reported here will aid in the design of small molecules for modulating the activity of the enzyme and altering flux through the pentose phosphate pathway.

AA Sequence

MASGCKIGPSILNSDLANLGAECLRMLDSGADYLHLDVMDGHFVPNITFGHPVVESLRKQLGQDPFFDMH      1 - 70
MMVSKPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIKPGTSVEYLAPWANQIDMALV     71 - 140
MTVEPGFGGQKFMEDMMPKVHWLRTQFPSLDIEVDGGVGPDTVHKCAEAGANMIVSGSAIMRSEDPRSVI    141 - 210
NLLRNVCSEAAQKRSLDR                                                        211 - 228
//

Text Mined References (20)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24816252 2014 An atlas of genetic influences on human blood metabolites.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
20923965 2011 Conversion of D-ribulose 5-phosphate to D-xylulose 5-phosphate: new insights from structural and biochemical studies on human RPE.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15901843 2005 Alu-SINE exonization: en route to protein-coding function.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
More...