Property Summary

NCBI Gene PubMed Count 18
PubMed Score 106.37
PubTator Score 115.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
group 4 medulloblastoma -1.100 2.5e-02
intraductal papillary-mucinous neoplasm ... 1.700 4.1e-02
lung cancer 1.200 5.3e-03
medulloblastoma, large-cell -1.200 3.4e-04
nasopharyngeal carcinoma 1.100 9.7e-04
ovarian cancer 1.200 9.5e-03

 GWAS Trait (1)

Protein-protein Interaction (2)

Gene RIF (1)

AA Sequence

MASGCKIGPSILNSDLANLGAECLRMLDSGADYLHLDVMDGHFVPNITFGHPVVESLRKQLGQDPFFDMH      1 - 70
MMVSKPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIKPGTSVEYLAPWANQIDMALV     71 - 140
MTVEPGFGGQKFMEDMMPKVHWLRTQFPSLDIEVDGGVGPDTVHKCAEAGANMIVSGSAIMRSEDPRSVI    141 - 210
NLLRNVCSEAAQKRSLDR                                                        211 - 228
//

Text Mined References (21)

PMID Year Title